KEGG   Helicobacter pylori HUP-B14: HPB14_05190Help
Entry
HPB14_05190       CDS       T02035                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00010  Glycolysis / Gluconeogenesis
hcn00020  Citrate cycle (TCA cycle)
hcn00620  Pyruvate metabolism
hcn00640  Propanoate metabolism
hcn00650  Butanoate metabolism
hcn00680  Methane metabolism
hcn01100  Metabolic pathways
hcn01120  Microbial metabolism in diverse environments
hcn01130  Biosynthesis of antibiotics
hcn01200  Carbon metabolism
Module
hcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPB14_05190 (porD)
   00020 Citrate cycle (TCA cycle)
    HPB14_05190 (porD)
   00620 Pyruvate metabolism
    HPB14_05190 (porD)
   00640 Propanoate metabolism
    HPB14_05190 (porD)
   00650 Butanoate metabolism
    HPB14_05190 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPB14_05190 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPB14_05190 (porD)
Enzymes [BR:hcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPB14_05190 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_7 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFI07722
UniProt: I0EXQ3
Position
1094043..1094435
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTDQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggggcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgatcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaagtta
aagggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcccgctaccgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system