KEGG   Halomonas chromatireducens: LOKO_00383Help
Entry
LOKO_00383        CDS       T04292                                 

Gene name
hdl_IVa
Definition
(GenBank) (S)-2-haloacid dehalogenase 4A
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
hco  Halomonas chromatireducens
Pathway
hco00361  Chlorocyclohexane and chlorobenzene degradation
hco00625  Chloroalkane and chloroalkene degradation
hco01100  Metabolic pathways
hco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LOKO_00383 (hdl_IVa)
   00361 Chlorocyclohexane and chlorobenzene degradation
    LOKO_00383 (hdl_IVa)
Enzymes [BR:hco01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LOKO_00383 (hdl_IVa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Glyco_transf_41
Motif
Other DBs
NCBI-ProteinID: AMC99479
UniProt: A0A0X8HBL9
Position
complement(390893..391654)
Genome map
AA seq 253 aa AA seqDB search
MSLTPPQLADIRCLAFDVFGTVVDWRSSVIREGESLGQARGLEVDWAAFADAWRAGYVPS
MSRVRQGRLSWTSLDQLHRMTLDRILEDFGITGLSEADKANFNRVWHRLKPWPDAVGGMH
RLRERFTLTTLSNGNMALLVNMAKQAGLPWDCVLSAELARHYKRDPEVYRMATRLLDLSP
QQIMMVSAHQDDLNAAKDEGLRTVFVMRPLEFGPEARPDLTIDPSFDYVANDFHDLADQL
LSRSEARQSLALS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaccccaccacagctcgccgatatacgctgcctggcatttgacgtctttggc
acggtggtcgactggcgaagtagcgtgatacgcgaaggtgagtccctagggcaggcccgc
ggactggaagtggactgggccgccttcgccgacgcctggcgcgcgggctatgtcccgtcg
atgagccgggttcgccaggggcgcctgtcctggacctcgctggaccagctgcatcgcatg
accctcgaccgcatccttgaggatttcggcatcaccgggctgtcggaagccgacaaagcc
aatttcaatcgcgtctggcaccggctcaagccctggccggatgccgtgggcggcatgcac
cgcctgcgcgagcggttcactctgaccaccctttccaatggcaacatggcgctgctggtc
aacatggccaagcaggccggcctgccgtgggactgcgtcctctcggccgagctggcccga
cactacaagcgtgaccctgaggtctaccgcatggcaacccggctactggatctgagcccg
cagcagatcatgatggtgtccgcccaccaggacgacctcaatgccgcaaaagacgaggga
ctgcgcaccgtcttcgtgatgcgcccgctggaattcgggccggaagccaggcccgacctg
accatcgacccgagcttcgactacgtggcaaacgatttccacgacctggccgaccagttg
ctgagccgttcggaagctcgccaatcgctggccctttcatag

DBGET integrated database retrieval system