KEGG   Halomonas chromatireducens: LOKO_00413Help
Entry
LOKO_00413        CDS       T04292                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
hco  Halomonas chromatireducens
Pathway
hco00310  Lysine degradation
hco01100  Metabolic pathways
hco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    LOKO_00413 (lhgO)
Enzymes [BR:hco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     LOKO_00413 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Amino_oxidase Thi4
Motif
Other DBs
NCBI-ProteinID: AMC99508
UniProt: A0A109UKV5
Position
complement(420942..422141)
Genome map
AA seq 399 aa AA seqDB search
MYDFTIIGGGILGLSTAMQLIERFPEKKIVLLEKEAGPAHHQTGHNSGVIHAGVYYAPGS
LKARFCLEGNRATREFCERHAIDFEICGKLLVATNGQEMQRMEALWERTGANGLEREWLS
AGALKEREPNITGIGGIFVPSSGIVNYARVAEAMATEFERHGGQIRYGHDVTALAERTGE
VIVTTSQGEFNSRYLVSCSGLMADRVVRLLGRNPGFTICPFRGEYYRLPDRHSGIVNHLI
YPIPDPSMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKSDFSLSDMARMFTNPGVLKV
LGRNLKPGLAEMKNSLFKKGYLAEVRKYCPSLTLEDLEPWPAGVRAQAVSRDGRLIDDFL
FVNTRRTVNVCNAPSPAATSAIPIGHHILEKVSEMVQST
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgacttcactatcattggcggcgggatcctcgggctttccactgccatgcagctg
attgaacgctttcctgagaagaagatcgtgctgctggagaaggaggcggggcccgcccac
caccagaccggccacaacagcggcgtgatccacgcgggcgtctactacgcccccggcagt
ctcaaggcgcgcttctgcctggagggcaaccgcgccactcgcgaattctgcgagcgccat
gccatcgacttcgagatctgcggaaagttgctggtggcgaccaatggccaagaaatgcag
cgtatggaagcgctgtgggagcgcaccggggccaatgggctggagcgggagtggctttca
gccggggcgctcaaggagcgcgagcccaatatcaccggcatcggcggaatcttcgttccc
tccagcggcatcgtcaattacgcgcgggtcgccgaggccatggcgaccgaattcgagcgc
cacggcggccagatccgctatggccatgacgtgacggcgcttgccgagcgaaccggtgag
gtgatcgtcaccacctcccaaggagagttcaacagccgctacctggtgagctgttcggga
ttgatggccgaccgggtcgtgcgcctgctgggccggaacccgggtttcaccatctgcccg
tttcgcggcgagtactaccgtttgcccgacaggcacagcggaatcgtcaaccatctcatc
taccccattcccgacccctccatgccctttctgggcgtacacctcacccgcatgatcgat
ggctcggtgacggtgggacccaatgcggtgctggcactgaagcgggaagggtatcgcaag
agcgatttctcgctgtccgacatggcacgcatgttcaccaatccgggagtgttaaaggtt
ctgggccgcaacctgaagccgggcctcgccgagatgaagaactcgctgttcaagaagggc
taccttgcggaggtgcgcaagtactgccccagcctgaccctggaagacctcgagccctgg
cccgccggggtgcgtgcccaggcggtttcccgggacggtcgactgatcgacgactttctg
ttcgtgaacacccgccgtacggttaatgtctgcaacgccccttcgccggcggccacttcg
gccattcccatcggacaccatatcctggaaaaggtcagcgagatggtgcagtccacctga

DBGET integrated database retrieval system