KEGG   Halomonas chromatireducens: LOKO_00528Help
Entry
LOKO_00528        CDS       T04292                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hco  Halomonas chromatireducens
Brite
KEGG Orthology (KO) [BR:hco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    LOKO_00528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMC99622
UniProt: A0A0X8HBK0
Position
complement(546445..546630)
Genome map
AA seq 61 aa AA seqDB search
MXVGQQPMIGPGQTFRYTSRAILDGPVGVMEGAYTCVDTASQRPFEVEIPPFRLATPNQI
H
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgcnggtcggtcaacagccgatgattggcccagggcagacctttcgctataccagtcgc
gctatcctggatgggccggtaggcgtcatggagggggcctatacctgtgtcgatactgcc
agccagcggcccttcgaggtggaaatcccccccttccgactggccactcccaaccagata
cactga

DBGET integrated database retrieval system