KEGG   Halomonas chromatireducens: LOKO_01079Help
Entry
LOKO_01079        CDS       T04292                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hco  Halomonas chromatireducens
Pathway
hco00540  Lipopolysaccharide biosynthesis
hco01100  Metabolic pathways
Module
hco_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    LOKO_01079 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hco01005]
    LOKO_01079 (hldD)
Enzymes [BR:hco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     LOKO_01079 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:hco01005]
 Unusual sugar
  LOKO_01079 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: AMD00156
UniProt: A0A109UL92
Position
complement(1141215..1142180)
Genome map
AA seq 321 aa AA seqDB search
MIVVTGGAGFIGSNLVKALNERGRTDVLVVDDLLDGTKFVNLADCTLGDYLDKDDFRERV
EAVLRGEPSRLPPIEAIFHEGACSDTTEWDGRFMLDNNFEYSKVLLHFCQLQGIPFIYAS
SAATYGGSQVFREEPEYEKPLNVYGYSKLLFDQYVREHWDELTSQVVGFRYFNVYGPREQ
HKGKMASVAFHHHTQISAGQDLKLFGAWDGYEAGMQSRDFVYVGDVVNVNLWFLDNPGKS
GIFNLGSGRAEPFKAIGEAVIDFHRQGRIEYIDFPEELKGRYQSYTRADISRLREAGYDG
EFRTVAEGVGEYLRWLGGETG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtgacaggcggtgccggcttcatcggttcgaatctcgtcaaggcactcaac
gagcgtggccgcactgacgtgctggtcgtcgatgaccttctcgacgggaccaagttcgtc
aatctggccgactgcacgctcggggattatctggacaaggatgatttccgcgagcgagtc
gaggcggtattgcgtggtgagccttcgcggttgcctcccatcgaagccatcttccatgag
ggagcctgctcggacaccaccgagtgggatggccgcttcatgctcgacaacaacttcgag
tactccaaggtgctgctgcatttctgccagctgcagggcatccccttcatctacgcttca
tcggcagcgacctacggtggtagccaggtctttcgcgaagagcccgagtacgagaagccg
ctcaatgtctatggctactccaagttgctcttcgaccagtacgtgcgtgagcactgggat
gagctgacgagccaggtggtggggttccgttacttcaatgtctacggcccgcgggagcag
cacaagggcaagatggccagcgtcgccttccaccaccacacccagatatcggcgggtcag
gacctcaagctgttcggcgcctgggatggctacgaggccggcatgcaaagtcgtgacttc
gtctatgtgggcgacgtggtgaacgtcaatctgtggttcctcgacaaccccgggaagtcc
ggaatcttcaacctgggctcggggcgtgccgagcccttcaaggcgatcggtgaagccgtc
atcgatttccaccgccagggcaggatcgagtacatcgattttcccgaagagctcaagggc
cgctaccagagctatacccgggccgatatctcacgcctgcgggaggcgggctatgatggc
gagttccgcaccgtggccgagggggtgggggagtacctgcgctggctcggcggagagact
ggatga

DBGET integrated database retrieval system