KEGG   Halomonas chromatireducens: LOKO_01248Help
Entry
LOKO_01248        CDS       T04292                                 

Definition
(GenBank) putative aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
hco  Halomonas chromatireducens
Pathway
hco00130  Ubiquinone and other terpenoid-quinone biosynthesis
hco00627  Aminobenzoate degradation
hco01100  Metabolic pathways
hco01110  Biosynthesis of secondary metabolites
hco01120  Microbial metabolism in diverse environments
hco01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    LOKO_01248
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LOKO_01248
Enzymes [BR:hco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     LOKO_01248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AMD00316
UniProt: A0A0X8HCX7
Position
1306513..1307175
Genome map
AA seq 220 aa AA seqDB search
MAEAKSDKGFKAAVTVAITGASGAQYGLRLIEALVAAEHEVWVMVSKAAHLVIATETDRE
LPARPERLAQALTERSAAAPGQIRCFGREDWMAPVASGSGASSAMVICPCSTGTLSAVAT
GASNNLIERAADVALKERRNLILVPRETPLSAIHLEHMLALSRLGAVILPAAPGFYHRPQ
GIDDLIDFIVARILNQLRIDHRLMPRWGEPQGEESDGENA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaaagtcggataagggcttcaaggcggcggtcaccgttgccattaccggc
gcttcgggggctcagtacgggctgcgcctgatcgaggcgctggtggcggctgaacatgaa
gtgtgggtgatggtgtccaaggcggcgcatctggtgatcgccaccgagaccgaccgggag
ctgccggcgaggcccgaacgcctggctcaggcgctgaccgagcgcagcgccgcggcgccg
ggccagattcgctgcttcggacgcgaggactggatggccccggtggcctccggctccggg
gcgtcgtctgccatggtgatctgcccctgctccaccggaacgctgtcggccgtggccacc
ggcgcgagcaacaatctgatcgagcgggccgccgacgtggcgctcaaggagcgtcgtaat
ctgatcctggtaccccgcgaaaccccgctgtcggcgatccatctcgagcacatgctggcg
ctgtcgcggcttggtgctgtgatcctgcccgccgcgccggggttctaccatcggccacag
ggcatcgacgacctgatcgatttcattgttgcccgaatcctcaatcagctccgcatcgac
caccggctgatgccccgctggggggagccgcaaggtgaagagagcgatggagagaatgct
tga

DBGET integrated database retrieval system