KEGG   Halomonas chromatireducens: LOKO_02540Help
Entry
LOKO_02540        CDS       T04292                                 

Gene name
tenA_1
Definition
(GenBank) Thiaminase-2
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
hco  Halomonas chromatireducens
Pathway
hco00730  Thiamine metabolism
hco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LOKO_02540 (tenA_1)
Enzymes [BR:hco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     LOKO_02540 (tenA_1)
Transcription factors [BR:hco03000]
 Prokaryotic type
  Other transcription factors
   Others
    LOKO_02540 (tenA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AMD01600
UniProt: A0A0X8HFG3
Position
2698662..2699330
Genome map
AA seq 222 aa AA seqDB search
MGYRFTDLTAACQDDWRAYTEHDFVRSLGAGTLAEDAFRHYLQQDYLFLIHFARAYALAA
YKSRTLADLRQAHEGLKAIVDVELGLHVGYCREWNISEEALASLPEARATMAYTRYVLDT
GNRGDLLDLHALPMAPCPCPKRATHDSIDGSSLRPRPARPTHLEHRPVGQPFIGLTIGLR
GLQVDADDVDTLRVGIASMINGAAIAFLTSVWGLRNKGRLTG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggctaccgctttaccgacctcaccgccgcctgccaggacgactggcgcgcctatacc
gagcacgacttcgtgcgcagcctcggggccggtaccctggccgaagacgctttccgccac
tacctgcagcaggactacctgttcctgatccacttcgcccgggcctatgccctggccgcc
tacaagagccgcaccctggccgacctgcgtcaggcccatgaaggcttgaaggccatcgtc
gacgtggagctgggcctgcacgtgggctactgccgcgagtggaacatcagcgaggaggcg
ctcgccagcctgcccgaggcccgggccaccatggcctatacccgctatgtgctggatacc
ggcaatcgcggcgacctgctcgacctgcacgccttacccatggcgccctgcccctgcccg
aagcgagcaacgcatgactctatcgatgggagcagcctccggccccgcccagcgcgcccg
acgcacctggaacatcgaccagtggggcagccctttattggcctgacaattggtttgaga
ggccttcaggtcgatgctgatgatgtcgataccctcagggtgggtattgcgagcatgata
aacggcgccgctattgcctttttgacatcagtatggggattacgaaacaaggggcgcttg
accggttaa

DBGET integrated database retrieval system