KEGG   Halomonas chromatireducens: LOKO_02619Help
Entry
LOKO_02619        CDS       T04292                                 

Gene name
fadA_1
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hco  Halomonas chromatireducens
Pathway
hco00071  Fatty acid degradation
hco00072  Synthesis and degradation of ketone bodies
hco00280  Valine, leucine and isoleucine degradation
hco00310  Lysine degradation
hco00362  Benzoate degradation
hco00380  Tryptophan metabolism
hco00620  Pyruvate metabolism
hco00630  Glyoxylate and dicarboxylate metabolism
hco00640  Propanoate metabolism
hco00650  Butanoate metabolism
hco00900  Terpenoid backbone biosynthesis
hco01100  Metabolic pathways
hco01110  Biosynthesis of secondary metabolites
hco01120  Microbial metabolism in diverse environments
hco01130  Biosynthesis of antibiotics
hco01200  Carbon metabolism
hco01212  Fatty acid metabolism
hco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOKO_02619 (fadA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    LOKO_02619 (fadA_1)
   00640 Propanoate metabolism
    LOKO_02619 (fadA_1)
   00650 Butanoate metabolism
    LOKO_02619 (fadA_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOKO_02619 (fadA_1)
   00072 Synthesis and degradation of ketone bodies
    LOKO_02619 (fadA_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOKO_02619 (fadA_1)
   00310 Lysine degradation
    LOKO_02619 (fadA_1)
   00380 Tryptophan metabolism
    LOKO_02619 (fadA_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOKO_02619 (fadA_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOKO_02619 (fadA_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LOKO_02619 (fadA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hco04147]
    LOKO_02619 (fadA_1)
Enzymes [BR:hco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOKO_02619 (fadA_1)
Exosome [BR:hco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOKO_02619 (fadA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMD01679
UniProt: A0A0X8HFI7
Position
2791408..2792598
Genome map
AA seq 396 aa AA seqDB search
MKEVYLADYARSAFTRAHPRKPEVDGWAGTRGDALLALVIDALLDRSGIDPQVVEDLSVG
CALPVKEQWNFGGRYPLWLSQRLGPHNHQCATRQIDQQCGSGLAALRSAAREIQAGAVDV
AITGGFENMTRVPMGPALFKEGVLTSPEALKDAEWLELEVALNMGITAERLAQGAGIERD
EMDAFALESHRRAARAEADSHLAGERLTLTNPAGEVIDRDANIRPDTNLERLAGLDPVFL
EGGRVTAGNSSPLTSGAAASVVMSAAALERHGAKPLARIVAIADVGVRPGLMGAGAAAAA
EQVLARAGLVASQIDAWEINEAFAAVPLHAMRKLGLDPGRVNVWGGALALGHPLGATGIR
LAGTLARILAHRGGRYGCATACVGGGQGIAVILERL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtctacctggccgactacgcccgcagcgcctttacccgcgcccacccacgc
aagcccgaagtggacggctgggccgggactcgcggcgatgccctgcttgccttggtaatt
gatgccctgctcgaccgtagcggtatcgacccgcaggtcgtggaagacctaagcgtcggc
tgcgcgctgccggtcaaggagcagtggaattttggcggccgctacccgctttggctttct
cagcgcctgggtccgcataaccatcaatgcgccacccgtcagatcgatcaacagtgtggc
tcggggcttgctgccctgcgcagcgccgcccgcgagatacaggcaggcgccgtggacgtg
gctatcaccgggggcttcgagaacatgacccgggtacccatgggccccgccctgttcaag
gaaggggtactgacttcacccgaggcgctgaaggatgccgaatggctcgagctcgaggtg
gcgctgaacatgggcatcaccgccgaacgcctggcccagggggccggtatcgagcgtgat
gaaatggatgcattcgcgctggagtcccaccgccgtgctgcccgggccgaggccgacagc
catctcgccggcgaacgacttacgctgaccaacccagccggggaggtcatcgaccgggac
gccaatatccgccccgataccaacctggaaaggctcgccggactcgatccggtcttcctc
gaaggcggccgggtcaccgccggcaacagctcgccgctcaccagcggtgccgctgcgtca
gtcgtgatgtccgcagctgctctcgagcgccatggtgccaagccgttggcccgtattgtc
gccatcgccgacgtgggtgtgcgccccggactcatgggcgccggggccgctgcggcggcg
gaacaggtgctggcgcgtgccgggctggtcgcctcacagatcgatgcctgggagatcaac
gaggcctttgccgccgtaccgctacatgccatgcgcaagctcggactggacccaggccga
gtcaacgtctggggcggcgccctcgccctggggcacccccttggggcgaccggcatacgc
ctggccggcactctggcacggatactcgcccatcgcggcggccgctacggctgtgccacc
gcttgtgtgggcggaggacaagggattgcggtgattctcgagcggctataa

DBGET integrated database retrieval system