KEGG   Halomonas chromatireducens: LOKO_02859Help
Entry
LOKO_02859        CDS       T04292                                 

Gene name
acnA_1
Definition
(GenBank) Aconitate hydratase 1
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
hco  Halomonas chromatireducens
Pathway
hco00640  Propanoate metabolism
hco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LOKO_02859 (acnA_1)
Enzymes [BR:hco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     LOKO_02859 (acnA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AMD01910
UniProt: A0A0X8HG22
Position
3052094..3054709
Genome map
AA seq 871 aa AA seqDB search
MNTDYRKPLPGTDLDYFDVRTAVDAIQPGAYDTLPYTSRVLAENLVRRCDPAMLTDSLKQ
LIERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAAKGGDPAKVNPVVPTQLIVDH
SLAVEHAGFEKDAFEKNRAIEDRRNDDRFHFINWTKTAFENVDVIPPGNGIMHQINLEKM
SPVVQVRPDEKGRRVAFVDTCVGTDSHTPMVDALGVISVGVGGLEAESVMLGRASYMRLP
DIIGVELTGKLQPGITSTDMVLALTEFLRRERVVGAYLEFYGEGASSLTVGDRATISNMT
PEYGATAAMFYIDEQTIDYLRLTGREDDQVALVERFAKETGLWADSLEKAEYERVLTFDL
SSVPRTLAGPSNPHALLPTSELASRGISGTVENEAGKMPDGAVIIAAITSCTNTSNPRNM
VAAGLIARNANKLGLTRKPWVKSSLAPGSKTVKMYLEEARLLPELEDLGFGVVAFACTTC
NGMSGALDPVIQQEIVDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTI
RFDIEKDALGFDQDGKPITLKDIWPSDEEIDAIVKASVKPEQFRETYIPMFDVDKGARAQ
VSPLYDWRPQSTYIRRPPYWEGALAGELSLKGMRPLAVLGDNITPDHLSPSNAIMMDSAA
GEYLHKMGVPEEDFNSYATHRGDHLTAQRATFANPKLLNEMVQENGAVKQGSLARVEPDG
KVTRMWEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIAAEGFERIHRTN
LIGMGVLPLQFEAGTTRKTLAIDGTETFDVVGEPRPRATLTLVINRRNGERVEVPVTCRL
DTAEELSIFEAGGVLQRFAKDFLESEVEAVG
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgactatcgcaaacccctgcccggcactgacctggattattttgacgtgcgc
accgccgtcgatgcgatccagcccggtgcctatgacacgctgccctacacctcgcgggtg
ctggccgaaaacctggtgcgccgctgcgaccccgcgatgctgacggattcgctgaagcag
ctgatcgagcgcaagcgcgatctggattttccctggtatccggctcgggtggtgtgccat
gacatcctcggccagacggcgctcgtcgacctggccggcctgcgcgatgccattgccgcc
aagggtggcgacccggccaaggtcaacccggtggtgccgacccagctgatcgtcgaccac
tcgctggccgtggagcatgccggtttcgagaaggatgccttcgagaagaaccgcgccatc
gaggatcggcgcaacgacgaccgcttccacttcatcaactggaccaagaccgccttcgag
aatgtggatgtgattccccccggcaacggcatcatgcaccagatcaacctggagaagatg
tcgccggtggttcaggttcgcccagacgagaagggaagacgtgtcgccttcgtcgatacc
tgtgtcggtaccgacagccacacgccaatggtcgatgccctgggcgtgatctccgtcggt
gtgggtggcctggaagccgagagcgtgatgctggggcgtgcctcctacatgcgtctaccg
gatatcatcggtgtcgaactgaccggcaagctgcagccgggcatcaccagtaccgacatg
gtgctggcgctgaccgagttcctgcgtcgcgagcgggtggtgggtgcctacctggagttc
tacggtgaaggggcctcgagcctgaccgtgggcgaccgggccaccatctccaacatgact
ccggagtacggcgccactgccgccatgttctatatcgatgagcagaccatcgactacctc
aggctgaccggccgcgaggacgaccaggtcgccttggtggagcgcttcgccaaggagacc
ggcctgtgggcggacagcctggaaaaggccgagtatgagcgggtattgaccttcgacctc
tcctcggtaccccgtaccctggccggtccctccaacccccatgccctgctgcccacctcg
gaactggcgtcccgtggcatcagcggcacggtggaaaacgaggcgggcaagatgcccgat
ggggcggtgatcatcgctgccatcaccagttgcaccaacaccagcaacccgcgcaacatg
gtggccgcgggtttgatcgcccgtaacgccaacaagctggggctgacccgcaagccctgg
gtgaagtcctccctggcgccgggctccaagacggtcaagatgtacctggaagaggccagg
ctgttgcccgagctggaagacctcggcttcggcgtggtggcctttgcctgcaccacctgc
aacggcatgagcggcgccctggacccggtgatccagcaggagatcgtcgaccgcgacctc
tatgccacggcggtgctgtcgggtaaccgcaacttcgacggccggatccacccctacgcc
aagcaggccttcctggcttcgcctccgctggtggtggcctatgccattgcaggcaccatt
cgcttcgacatcgagaaggacgcgctgggcttcgaccaggatggcaagcccatcacgctg
aaggatatctggcccagcgacgaagagatcgatgccatcgtcaaggccagcgtgaagccc
gagcagttccgcgagacctatatcccgatgttcgatgtggacaagggcgcgcgggcccag
gtgagcccgctctacgactggcggccccagagcacctatatccgccgtccgccctactgg
gagggtgccctggccggcgagctttcgctcaagggcatgcgtcccctggcggtactcggc
gacaacatcacccccgatcacctgtcgccatcgaatgccatcatgatggacagcgcggcg
ggtgagtacctgcacaagatgggcgtgccggaggaggacttcaactcctacgccacccat
cggggcgaccacctcacggcccagcgcgccaccttcgccaatcccaagctgctcaacgag
atggtgcaggagaacggtgcggtgaagcaggggtcgctggcgcgggtcgagccggacggc
aaggtcacccgcatgtgggaggcgatcgagacctacatggagcgcaagcagccactgatt
atcatcgccggtgccgactacggccagggctcttcccgtgactgggcggccaagggcgtg
cgtctggccggggtggaggccatcgccgcggaaggcttcgagcgtattcaccgtaccaac
ctgatcggcatgggggtgctgccgctgcagttcgaagcgggtaccacgcgcaagacgctg
gctatcgacggcaccgagaccttcgatgtggtgggcgaaccgaggccccgtgccaccctg
acgctggtgatcaaccgcaggaacggcgagcgcgtggaagtgccggtgacctgccgtctc
gataccgccgaggagctctcgatcttcgaagccggcggcgtgctgcagcgcttcgccaag
gacttcctcgagtccgaggtcgaagcggtcggctga

DBGET integrated database retrieval system