KEGG   Halomonas chromatireducens: LOKO_02916Help
Entry
LOKO_02916        CDS       T04292                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hco  Halomonas chromatireducens
Brite
KEGG Orthology (KO) [BR:hco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hco03016]
    LOKO_02916 (truC)
Enzymes [BR:hco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     LOKO_02916 (truC)
Transfer RNA biogenesis [BR:hco03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    LOKO_02916 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AMD01964
UniProt: A0A0X8HG28
Position
complement(3102860..3103627)
Genome map
AA seq 255 aa AA seqDB search
MSEALTILHQDEHLVAVHKPAGLLVHRSALARGEREFLLQRLRDQLGQRVYPVHRLDRPT
SGAMIFALSKAAAARLADAFTERRVTKRYLAVVRGVGPEHDWLDYPLREEDGTRPKAEMP
AMEALTEVRRLDSVELPVQVDRYPQSRYSLMQASPVTGRRHQIRRHLSQRGYPIIGDAKH
GKGNHNRFFKERLACPRLLLAAVCLAFDHPFEAYRLTLSCALDAPMSALFERFGWGGHLP
VNGTSLSAPNLEPSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagcgctgacgattctccatcaggacgagcacctggtcgccgtgcataagccg
gcaggcctgctggtgcatcgctctgccctggcccgaggtgaacgcgaattcctgctgcag
cgactgcgcgaccagctcggccagcgggtctatccggtacaccgccttgaccgccccacc
tcgggggcgatgatcttcgccctgtcaaaggcggcggcagcccggctcgcggacgccttt
accgagcgccgggtcaccaagcgctacctggcggtggttcgcggcgtcggccccgagcac
gattggctcgactaccccctgcgcgaagaggatggcacccgccccaaggcggaaatgccg
gccatggaggcgctaaccgaagtcaggcggctcgacagcgtcgagctgccggtgcaggtg
gaccgctacccccagagccgctactcgttaatgcaggcatcgcccgtgaccgggcgccgc
caccagatacgccgccacctgtcgcagcggggctatcccatcatcggcgacgccaagcac
ggcaagggcaaccacaaccgcttcttcaaggagcggctggcgtgtccgcggctgctgctg
gccgccgtgtgcctcgccttcgatcatccgttcgaagcgtatcgcctgaccttgagctgc
gccctggacgcccccatgtcggccctgttcgagcgctttggctggggcggccacctgccg
gtgaacggcaccagcctcagcgcccccaacctcgaaccctccgcctga

DBGET integrated database retrieval system