KEGG   Halomonas chromatireducens: LOKO_03051Help
Entry
LOKO_03051        CDS       T04292                                 

Gene name
cobB_2
Definition
(GenBank) Cobyrinic acid A,C-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
hco  Halomonas chromatireducens
Pathway
hco00860  Porphyrin and chlorophyll metabolism
hco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LOKO_03051 (cobB_2)
Enzymes [BR:hco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     LOKO_03051 (cobB_2)
    6.3.5.11  cobyrinate a,c-diamide synthase
     LOKO_03051 (cobB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DUF1611
Motif
Other DBs
NCBI-ProteinID: AMD02099
UniProt: A0A0X8HGC1
Position
complement(3256478..3257866)
Genome map
AA seq 462 aa AA seqDB search
MASPWLPPRSTVPPFSFLRGDMTTTTIRGECHAALITAPGSGQGKSMVTAALARLHRNAG
RKVRVFKHGPDYLDPMVQEVASGQPVYQLHPWMTGEAECRWRLAEAAREADLILVEGSMG
LFDGDPSSADLAILAGLPALPVIDAWGMAQTFGAVAQGLANYHPGLAIHEVIANRVGSPG
HGRLLAESMPVGLSLLGAIPRHEAMTIPDRHLGLVQAGELAGLDAQLDAAAEVLKEAGLD
RLPARVTLEAEAPEPPPRLLDGVQIAVARDDAFAFLYRANLDLLTQMGAELHFFSPLVES
ELPACDALWLPGGYPELHAAKLAANAPMLGAIRVHREAGKPILAECGGLMACMESLVDGE
GRKHPMLGLLPGTARMAGKLTALGLQSLTTESGELRGHTYHHSLLETPLEPAAHARRLAG
SPAEPVFVEGRLVASYFHGYFPSAPALTAAIFCGEPLRFTKE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcccctggctaccgccgagatcgacggttcccccgttttcgttcctgcgaggt
gatatgacaaccacaaccattcgcggcgagtgccacgccgccttgatcaccgccccaggc
tccggccagggcaagtccatggtcaccgcggcgctggcgagactgcaccgcaatgcgggc
cgcaaggttcgtgtcttcaaacatggcccggattatctcgaccctatggtgcaggaagtg
gcctcgggccagccggtctatcagctgcatccctggatgaccggcgaggccgagtgtcgc
tggcggctggccgaggccgcccgggaagccgacctgatcttggtcgagggctccatgggg
ctgtttgacggcgacccgtccagcgccgatctggcgatactcgccgggctgccggcgctg
ccggtgatcgatgcctggggcatggcccagaccttcggtgccgtggcccaggggttggcc
aactatcatcccggcctggccattcacgaggtgatcgccaaccgggtcggcagcccgggt
cacggcagattgctggcggagagcatgccggtggggctctccctgctcggtgccattccg
cgacatgaggcgatgaccatccccgaccgccacctgggactggtgcaggccggcgaactc
gctggcttggatgcgcaacttgatgccgccgccgaggtgctcaaggaggcgggcctcgac
cgcttgccggcacgggtgacgctcgaggccgaggcccccgagccgccgccgcgcctgctc
gatggcgtacagatcgccgtggctcgggacgacgccttcgcctttctctatcgcgccaac
ctcgatctgctgacgcagatgggcgccgagctgcatttcttctcgccgctggtcgagtcc
gagctacccgcatgcgacgccctctggctgcctggtggctaccctgagctgcacgcggca
aagctcgctgccaatgcgccgatgcttggcgcgattcgcgtccatcgagaggcaggaaag
ccgatcctcgccgagtgcggtggcctgatggcgtgtatggagtccctggtggatggtgag
gggcgcaagcatcccatgctggggctgttgcccggcaccgcacgcatggccggcaagctg
acggccctgggcctgcaaagcctgacgaccgagagcggggagctgcgtggccacacctac
caccactcgctgctggaaacacctctcgagccggcggcccacgcccggcgcctggctggc
agtcctgccgagccggtctttgtcgaaggcaggctggtagcaagctatttccatggctat
tttccttcggcgccggcattgaccgctgccatcttttgcggcgaaccgctgcgtttcact
aaggagtga

DBGET integrated database retrieval system