KEGG   Helicobacter cinaedi PAGU611: HCN_0878Help
Entry
HCN_0878          CDS       T02034                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
hcp00020  Citrate cycle (TCA cycle)
hcp00620  Pyruvate metabolism
hcp01100  Metabolic pathways
hcp01110  Biosynthesis of secondary metabolites
hcp01120  Microbial metabolism in diverse environments
hcp01130  Biosynthesis of antibiotics
hcp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCN_0878
   00620 Pyruvate metabolism
    HCN_0878
Enzymes [BR:hcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HCN_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAM12131
Position
888729..890216
Genome map
AA seq 495 aa AA seqDB search
MSEDSEVVLVGGGIMSLTLAAMLKELKPSAHISVYEMLDDVALESSMVWNNAGTGHQALC
ELNYTPKKEDGSIDISKAVRINQQYELSKEFWAYCVETGILKEPQTFLNPVPHLSFVVDH
IVPYLKQRYETLTSSCPLFKNMIYSEDKEQIKQWAPLLLEGRDTNQPIAATYMQEGTDVD
FGEIVRQFKEKLSQKDNFNVYVNHKVQNLIKQGNAWLLDVLDTKSGEKKQVKAKFVFLGA
GGGSFPLLQKSGIPEGRGYGGFPVGGLWLVCKNRDVIDKHNAKIYGKASIGDPPMSVPHL
DTRIIQGKKELLFGPYAGFNTKFLKHGSLLDFPMSVRLSNFLPMFQAGIDNVPLTIYLIK
QILMSNKQRMRKLHVFFPDAKLEDWEALFAGQRVQIIKKDSKGRGSLQFGTEVITSSDGS
LAALLGASPGASTAADIMLQVLERCFGEEMKSSEWKDKLAEMIPSYKRPLEEKITHFNEW
RSKTAQILKMPFCAI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggattcagaagtagttttagttggtggagggattatgagcttgacattagca
gcaatgctaaaagagcttaagccttcagcacatattagtgtatatgaaatgcttgatgat
gtggcgttggaaagcagtatggtatggaacaacgctgggacaggacatcaggcactttgt
gagttaaactacacgccaaaaaaagaagatggtagcattgatatttcaaaagcggtaaga
attaatcagcaatatgagcttagcaaggagttttgggcatattgtgtagaaactggaatc
ttaaaagaaccacagacttttttaaatcccgtgccacatttaagctttgtggtggatcat
atcgtgccgtatttaaagcaacgctacgagacacttacatcaagctgtccgctttttaaa
aatatgatttattccgaagataaagagcagattaagcaatgggctccgcttttgcttgaa
gggcgagatacgaatcagcccattgctgcgacatatatgcaggaaggcacagatgtggat
tttggcgagattgtaaggcagtttaaagaaaagcttagccaaaaggataactttaatgtt
tatgtgaatcacaaagtgcaaaatcttatcaagcagggcaatgcttggctcttagatgtg
ctagatacaaagagtggagaaaaaaagcaagttaaggcgaaatttgtatttttaggtgca
ggtggtggatcgtttccattattgcaaaaaagtggcatacccgaagggcgtggctatggt
ggattccctgtgggtgggctgtggcttgtgtgtaaaaatcgcgatgttattgataagcat
aatgcaaagatatatggcaaggcgtctattggcgatccaccgatgtcagtgccacatttg
gatacgcgtattattcaaggtaaaaaagagttgctttttggtccatatgcgggatttaat
acgaagttcttaaaacacggcagtttgcttgatttccctatgtctgtgcgtttgagtaac
tttttgcctatgtttcaagcaggtattgataatgtgcctttgacgatttatttgattaag
cagattctaatgtcaaacaagcagagaatgcgtaagcttcatgtgtttttccctgatgcg
aagctggaggattgggaggcgttatttgctggacaaagggtgcagattatcaaaaaagat
agcaagggcaggggaagtttgcaatttggtacggaagttatcacttcaagtgatggaagc
ttggcagcattgcttggagcatcgccgggagcttcaacagctgcggatattatgctacaa
gtgcttgagcgatgttttggtgaagagatgaaaagtagtgaatggaaagataaacttgcc
gagatgataccatcatataaacgaccattggaggagaaaatcacgcattttaacgagtgg
cgttccaaaacagcccagattctcaaaatgcctttttgtgcgatttag

DBGET integrated database retrieval system