KEGG   Helicobacter cinaedi PAGU611: HCN_1425Help
Entry
HCN_1425          CDS       T02034                                 

Definition
(GenBank) type VI secretion protein EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
hcp  Helicobacter cinaedi PAGU611
Brite
KEGG Orthology (KO) [BR:hcp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hcp02044]
    HCN_1425
Secretion system [BR:hcp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HCN_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB Ku_PK_bind
Motif
Other DBs
NCBI-ProteinID: BAM12627
Position
complement(1419786..1421240)
Genome map
AA seq 484 aa AA seqDB search
MSSDKVVDTPIIESIMEKSKYLKNDESYSIAKRGVAEFISAIVENDDVEDKINKFALDEM
IAHIDDLVSKQMDEILHNEDFQKLESVWRGLYFLVERTDFNENIKINLFDVTKEEALEDF
ENNPDITQSVIYKNIYSSEYGQFGGEPVGAIIGDYQLSTNSPDMTFLNKMASIAAMSHSP
FLTSCAPSFFGLENYSELANIQDLGGLLQGPQYTRWRTFRENEDSKYVGLMVTRFLTRSP
YSPEENPIKTFNYKENVHNSHNHLLWGNSAYAFATRLTESFAKYRWCGSIIGPKSGGSVK
DLPTYLYESFGTMQSKIPTEVLITDRREYELAEAGFIALTLRRDSNNAAFFSANSALKPK
VFPNTPEGKEAETNYRLGTQLPYIFLISRLAHYLKVLQREEIGSWKERTDIENGLNEWVR
QYISDQENPPAEVRSRRPFRGAQIKVDNVAGEPGWYKIGLSVRPHFKYMGGNFELSLVGK
LDKE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgataaagtggttgatacacctattattgaaagcattatggaaaaaagtaag
tatttaaaaaatgatgaaagttatagtatagctaaaagaggtgttgccgaatttatctct
gctattgttgagaatgatgatgtagaagataaaattaataaatttgctttagatgagatg
atagcacatattgatgatttagtatctaagcaaatggacgagattctacacaatgaggat
ttccaaaaactagagtctgtatggagaggcttatatttcttagtagaaagaacagatttt
aatgaaaatattaaaatcaacctttttgatgtaaccaaagaagaagctttagaagatttt
gagaacaatcctgatattacccaaagtgtcatttataaaaatatttattcttcagaatat
ggacaatttggtggagagcctgttggtgctatcataggcgattatcagcttagcaccaat
agtccagatatgacttttttaaataaaatggcaagtattgctgcaatgagccattcgcca
tttttaacctcttgtgctcctagtttttttgggttagagaattattcagagttagcaaat
attcaagatttaggaggtttgcttcaaggtcctcaatacactagatggagaacctttaga
gaaaatgaagattcaaaatatgtggggcttatggtaacaagatttttaacacgctctcct
tatagtccagaagaaaatcctatcaaaacttttaattataaagaaaatgttcataattca
cataatcatttattatggggcaattcagcttatgcctttgctacaagattaactgaaagt
tttgcaaaatatagatggtgtggaagtattataggtccaaaaagtggagggagcgtgaaa
gatttacctacttatctttacgagagttttggcactatgcaatccaagattccaaccgaa
gtgcttattacagatagaagagaatatgagcttgctgaagcagggtttattgctttgact
ttaagaagagatagtaataatgcagcttttttctctgcaaattcagctttaaaacctaaa
gtatttccaaatacacctgagggaaaggaagcagaaacgaattatcgattgggaacacag
cttccttatatattccttatatcaagattagcacattatcttaaggttttacaaagagaa
gaaataggtagttggaaagaaagaactgatattgaaaacggactcaacgaatgggtaaga
caatatatttcagaccaagaaaatcctcctgctgaagtccgaagtaggagaccatttaga
ggagctcagatcaaagtggataatgtggctggagagccgggatggtataagatagggctt
agtgttcgccctcattttaaatatatgggcggaaatttcgaactttcattagtgggcaaa
cttgataaagagtga

DBGET integrated database retrieval system