KEGG   Helicobacter cinaedi PAGU611: HCN_1709Help
Entry
HCN_1709          CDS       T02034                                 

Gene name
pldA
Definition
(GenBank) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
hcp00564  Glycerophospholipid metabolism
hcp00565  Ether lipid metabolism
hcp00592  alpha-Linolenic acid metabolism
hcp01100  Metabolic pathways
hcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HCN_1709 (pldA)
   00565 Ether lipid metabolism
    HCN_1709 (pldA)
   00590 Arachidonic acid metabolism
    HCN_1709 (pldA)
   00591 Linoleic acid metabolism
    HCN_1709 (pldA)
   00592 alpha-Linolenic acid metabolism
    HCN_1709 (pldA)
Enzymes [BR:hcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HCN_1709 (pldA)
    3.1.1.32  phospholipase A1
     HCN_1709 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: BAM12888
Position
complement(1694087..1695010)
Genome map
AA seq 307 aa AA seqDB search
MCCVVWADESQTHTQNAENENPADKSLELLSQDSQNKQQDDKKAESHNTSNAVSTITEDS
NFSSHYLALYRHKSVYILPFYHSFSDPAVGNNDTETKFQFSFKMPVIKGHFSPYGSLYFA
YTQTAWFQNYNKEDSRPFRDIDYQPELFYSYEAPIAFLGGAIKDISFGYNHTSNGERALR
SRTQNRLLLRVLWEYDTANKGTFGIRLGAWAYIGTNFEGFIHDNRDLPLYRGYNDLHLYY
KTNKHLLELYMRPPVALRYYPYVELGYTLRISKNMGIYCQYVNGYGDNLFEYKMHSHRLG
LGFRLWN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgtgttgtgtgggcagatgaaagtcaaacgcatacacaaaatgcggagaatgaa
aatcccgcagataaatccttagagcttttatcccaagattcacaaaacaaacagcaagat
gataaaaaagcagaatctcataacacatcaaatgcggtttctacaatcactgaagattct
aatttttcaagccattatctagccctttatcgtcataaatcagtgtatattttgcctttt
tatcatagttttagtgaccctgctgtggggaataatgacacggagacgaagtttcaattt
agctttaaaatgcctgtgataaaagggcatttttcaccttatgggagcttgtattttgcc
tatacgcaaactgcgtggtttcaaaactacaacaaggaagattctcgcccattccgcgat
attgactatcagcccgagctgttttatagctatgaagcccccatcgcctttttgggtggg
gcgattaaggatatatcatttggttacaatcacacttctaatggcgaaagggcgttgcgt
tctcgcacacaaaatcgccttttgctccgtgtgttgtgggaatacgatactgcaaacaaa
ggcacttttggcataaggcttggagcgtgggcgtatattgggacaaattttgagggcttt
atccacgataatcgcgatttgcccctgtatcgtggatacaatgacttacatttgtattac
aaaacaaataagcatcttttggaattgtatatgcgtccgcctgtggcattgcgatattat
ccttatgtagagcttggctatactctccgtatttctaagaatatgggaatctattgtcaa
tatgtcaatggctatggcgataatctctttgaatataaaatgcactcacatcgtttgggg
ctaggattccgtttgtggaattag

DBGET integrated database retrieval system