KEGG   Hippocampus comes (tiger tail seahorse): 109507819
Entry
109507819         CDS       T04969                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109507819 (ahrr)
Transcription factors [BR:hcq03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109507819 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 zf-RNPHF PAS_9
Other DBs
NCBI-GeneID: 109507819
NCBI-ProteinID: XP_019713052
UniProt: A0A3Q3DDJ9
Position
Unknown
AA seq 684 aa
MIPPGDCMYAGRKRRKPVQKQKPSSANEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQANQDKVPRKHNNTASSNPEPGRKESVPMCTGVNESGLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRSQLHWAMC
PRQHQGASAHQDAQLAAGTGDEFVVSSLFHSPEAGGIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLQGQKKKSASGAPLPPQLALFCIAVPLLLPSITEMKMKNMLMRGKN
KSGGGIISALEHGDRGEHLRRHSFSGGMGDVTDPLLLSCPAAVGTQRGQHTPWTPLTKDN
LKFRPDGYYNQEEPLNFCKSSMSSHKGLGPGLGSAWPLRPNSGHLRAGQGVGYIPTNRLN
KAGQYGKPYRLSPSCHSGRNGEVFVSKLYGSLQIPADPDAYCVDLVKSENGYGECYDGHL
MPPIKVEHDSDSENGCDPFGRPWAHRDPDAIDRRYGNGAYDQSTGVQLKSEADYYDLQYS
PCQRGKAGISPPYNSGNYQNYAVNNSGRLLKCDKDLANNNDNSQFSPHRLSHSQCSNQSV
NLIDSHVYQQEPQKPYMHQDFDKHGTYEFKGHGLIHSIKREPIDSPPWSEGGHDMSQPMM
VAPRNIMSCVSTGHHKSSPYVYMP
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgatccctcctggagactgcatgtacgcgggcaggaagcggaggaagcccgtccaaaag
cagaagccgtcgtctgctaatgagaaaacgaacccgtccaagcggcaccgggacaggctg
aatgccgagttggaccggctggccagcctgctgccgttcccgccggatgtcatctccaaa
ctggacaaactgtctgtgctgcgccttgcagtttcctacctccgcgtcaagagtttcttc
caagcaaatcaagacaaggtgcccaggaagcacaacaacactgcatcctccaaccccgaa
cccggcaggaaagaaagtgtcccaatgtgcacgggcgtcaatgaaagcggcctgctcttg
gagtctctaacaggatttgccctggtggtgagcagtgacggaatggtcttttacgcctct
tcaaccattgtggactatctgggattccatcagactgatgtgatgcaccagaacgtgttt
gactacatccacatagatgaccgccaggagttccgaagccagctccactgggccatgtgc
cctcggcaacaccagggggcatcagcacatcaggacgcccagctcgctgcagggaccggt
gacgagtttgtggtgagcagcctgttccactctccagaggcggggggcattcctcctgag
ctctcctgctttctcaacagatgtttcatagcaagggtccgatgcctgttggacagcaca
tctggattcctgacaatgcagtttcagggtcggctgaagtttctccaaggacagaaaaag
aagtccgcctccggggctccgcttcctccccagctggctctcttctgcatagctgtaccc
cttttactgccctccattaccgaaatgaaaatgaagaacatgttaatgcgaggaaagaac
aagagcggaggagggattatctcggcactagagcacggagatcgaggggaacacctccga
aggcattccttcagtggaggaatgggcgacgtaacagaccctctcctgctctcctgtcca
gccgctgttggcacccagaggggccagcacactccctggaccccactcaccaaagataac
ctcaagttccgccctgatggctactacaaccaggaagagcccctcaatttctgcaagtca
tcaatgtcttcccataagggcctcggtccgggcctggggagcgcttggcccctgcgacca
aactcggggcacctcagagcgggccaaggggttggctacatcccaactaaccgcttaaac
aaggccggccaatacgggaagccataccgcctttccccgagctgccatagcggcaggaat
ggcgaggtgtttgtgtcgaaactctatgggagcctgcagattcccgcggacccggacgcc
tactgcgtggatttagtcaagagtgagaacggctacggcgaatgctacgacggccatttg
atgccgcctatcaaagtagagcacgactccgactcggagaacggctgcgatccgttcggg
cgaccctgggcgcatcgggatccggacgcgatcgaccgtcgctatggtaacggggcgtac
gatcagagcaccggcgtccagctcaaatccgaggcggattactacgatctgcagtactcg
ccctgtcaacggggcaaagcggggatcagcccaccgtacaacagcggcaactatcagaac
tatgcagtgaacaacagcggacgtttgttaaaatgtgacaaagacttggctaataacaac
gacaacagtcagtttagcccccatagactctctcactcccagtgcagtaatcaatcggtc
aacctcattgactctcacgtctaccaacaggagcctcaaaagccctacatgcaccaggac
tttgacaagcacggcacttacgagttcaaaggtcacgggctgatccattccatcaaaagg
gagcccattgactccccgccgtggtctgagggcggccatgacatgagccagcccatgatg
gttgctccaaggaacattatgtcatgtgtgagcacggggcatcacaaatccagcccttac
gtttatatgccctaa

DBGET integrated database retrieval system