KEGG   Hippocampus comes (tiger tail seahorse): 109508379Help
Entry
109508379         CDS       T04969                                 

Gene name
nit1
Definition
(RefSeq) nitrilase homolog 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109508379 (nit1)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     109508379 (nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 109508379
NCBI-ProteinID: XP_019713881
UniProt: A0A3Q2YZ31
Position
Unknown
AA seq 317 aa AA seqDB search
MLFALSSSVEIGALLSVWTSKLYYRMSSSCRPCAALCQLNVTADKQANLCAAQGLLEEAK
QRGACMAFLPEAFDYIGSSREETLALSETLAGHTMMRYTQMARKLDIWLSLGGFHERGSD
WEAEQRIYNCHVVINNHGEIVSTYRKCHLFDVELPEKGVSLNESTFTVPGPSLVAPVQTP
IGKLGLGVCYDLRFPEFSLALQKSGAEILTFPSAFTVTTGAAHWEVLLRARAIENQCYVL
AAAQVGRHHDRRSSYGHSLAVDPWGTVAADCGGERAGVALVEVDLAQIRSLRRNMPLHEH
RRDAAFYASLEGGRRVK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcgcgttgagctcatcggtcgagattggtgccttgctctccgtttggacaagc
aagctatactacaggatgtccagctcttgtcggccgtgcgccgccttgtgtcagttgaat
gtcaccgcagacaagcaagccaacttgtgtgctgcccaagggttgctggaggaggcaaag
cagcgaggcgcctgcatggccttcctgcccgaggctttcgactatatcggctccagtcgg
gaagagaccctggcgctttcggagaccttggcgggacatacaatgatgcggtacactcag
atggccaggaaattggacatctggctgtctctgggggggttccacgaacggggatccgac
tgggaggccgagcagcgaatttacaactgccacgttgtcattaacaaccacggcgagatt
gtgtctacctacaggaaatgccacctgtttgacgtcgagcttcccgagaagggcgtctcg
ctcaacgaaagcaccttcaccgtcccgggtccctcgctggtcgcgcccgtccaaaccccc
atcggcaagctcggattgggcgtctgctacgacttgagattcccagaattttcactcgcg
ttgcagaagagcggcgctgagatcctgacgttcccatcggccttcaccgtgaccacagga
gccgctcactgggaggtgctgctgcgggcgcgggccatcgagaaccagtgttacgtcctg
gcggcggcacaggtcggccggcatcacgacaggcgctcctcttacggccacagcctggcc
gtggacccctgggggacggtggcggccgactgcgggggggagcgagcgggcgtggcgctg
gtggaggtcgatctggctcaaatacgcagcctccgccggaacatgccgcttcatgagcat
cgcagggacgccgccttttacgccagcctggagggaggacgtcgagtgaaatag

DBGET integrated database retrieval system