KEGG   Hippocampus comes (tiger tail seahorse): 109508767
Entry
109508767         CDS       T04969                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00100  Steroid biosynthesis
hcq01100  Metabolic pathways
Module
hcq_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109508767 (tm7sf2)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109508767 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 109508767
NCBI-ProteinID: XP_019714303
Position
Unknown
AA seq 425 aa
MRSKSQTSNGKASHNTEREFGGTLGAVCIPIFLPLTVLFLICVNRSPDAALLQWPPPLPS
LDQLWNPTAPLLLLGWIALHAFLYLLPLGKISEGLVLRDGTRLKYPINGFHSLCISGALL
MLLLMFKAPLGHLFEMMLPLAVCAIAVSFMLSVYLYLSSFWAPPHALALGGNTGNPLYDY
FIGRELNPRIGHFDLKYFCELRPGLIGWVVINFGMLMQEVELRGSPSLAMMLVNSFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQAAFLVGHPQTLSPMGVAAT
ITLNGIGYYIFRKSNSQKNQFRRSPTHPSVSRLETIATATGKRLLVSGWWGLVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYVIYFTVLLIHREARDERHCRAKYGLAWETYCRRVPYRI
IPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaggtcaaagagtcaaacatcaaatggcaaggcttcccataacacagagagagagttt
ggaggaaccctaggggccgtttgcatccccatctttctgccattgacggtgcttttcctg
atttgcgtcaatcgatctcctgacgcagctctgctccagtggccccctcccttgccctca
cttgaccaactgtggaaccccacggctcccctcctcttgctgggctggatagctctgcat
gctttcctgtatttgctaccattaggaaagatatctgagggattagtgctgagggatgga
acacgtctcaagtatcccataaacggttttcatagcttgtgcatcagcggcgcattgctg
atgttgcttctgatgttcaaggctcctttggggcatctgttcgagatgatgttgcctctg
gctgtgtgtgcaatagcagtgtccttcatgctctctgtctatctctacctttcttccttt
tgggctcctcctcatgctcttgctttggggggcaacacaggaaatccactgtatgactac
ttcattggacgggagctgaaccctcgtataggtcattttgacttgaaatatttctgtgag
ctcagaccaggtctgattggctgggtggtcataaactttggtatgctgatgcaagaggtg
gagcttcgaggctctccctcactcgccatgatgctcgtcaacagttttcagttgttgtat
gtggctgacgctctgtggaatgaggaggcggttttgaccacgatggacattgtgcatgat
ggttttggcttcatgcttgtcttcggtgacctggcctgggttcccttcacatacagcctg
caggcggcctttctagtcggacatcctcaaacactaagtccaatgggagttgccgcgaca
ataactttaaatggtattggctattatattttccgaaaatccaactcacagaagaatcaa
ttccggagaagccccacacatccaagtgtttcaaggctcgagaccatcgccacggcaaca
gggaagcgtttgctggtgtctggttggtggggtctcgttcgtcatcccaattacttgggt
gatctcctcatggccttggcttggtctctgccttgtggattctcacatcttctgccatac
ttctatgtgatatatttcaccgtcttgctgattcaccgtgaggcccgcgacgagcgacac
tgcagagccaagtatggacttgcatgggaaacatattgtcgacgtgtcccctacaggatc
atcccttatatttactga

DBGET integrated database retrieval system