KEGG   Hippocampus comes (tiger tail seahorse): 109509263Help
Entry
109509263         CDS       T04969                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109509263
Membrane trafficking [BR:hcq04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109509263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2
Motif
Other DBs
NCBI-GeneID: 109509263
NCBI-ProteinID: XP_019714701
Position
Unknown
AA seq 184 aa AA seqDB search
MAGKHSERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSD
DVVSPDEEGICSGKYFTELGLVGLLEQAASSFSLAGMYEAVNEVYKVLIPVHEANRDAKK
LATIHGKLQEAFGKIVHQVNMYDTIMSSEHRLYTALIDATCYLFYADRHMCTFFQNDVLS
SYLN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaacactctgagaggaacaaccatgctgaagctgctcagtgtttagtgcac
agtgctgccttggttgcggaatatctgagcatgttagaggaccgcaagtatctacctgtg
ggctgcgtgaccttccagaatatttcatccaacgtgctggaggaatctgccgtctcggat
gatgtggtgtcaccagatgaggaaggcatctgctcgggaaaatattttacagagctgggg
cttgtgggactcttggagcaagctgcttcatcattctctttggctggcatgtacgaggct
gtgaatgaagtgtacaaggtactgatccccgtccatgaagccaacagagatgccaagaag
ttagccaccattcatggtaaactacaggaagcctttggcaaaattgtccatcaggtaaat
atgtatgatactataatgtcatccgaacaccgactgtatacagctttaatagatgcgacc
tgctatttgttttatgccgaccgacatatgtgcacttttttccagaatgatgttctgagt
tcatatttaaattga

DBGET integrated database retrieval system