KEGG   Hippocampus comes (tiger tail seahorse): 109509416Help
Entry
109509416         CDS       T04969                                 

Gene name
ltb4r
Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109509416 (ltb4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hcq04030]
    109509416 (ltb4r)
G protein-coupled receptors [BR:hcq04030]
 Rhodopsin family
  Lipid
   Leukotriene
    109509416 (ltb4r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 109509416
NCBI-ProteinID: XP_019714825
Position
Unknown
AA seq 265 aa AA seqDB search
MVSNSTAAFSLPVSTSAKVGIAILTLAFALGFPGNLFVVWSVVCRVQKRSVTCLLVLNLA
VADALVLLTSPIFLRYLAGGQGWEFGSAACKLVHYLCNVNMYVSIYLICLMSMDRWLAVS
RPFMSQKMRTKRSLLFLLLGVWIMAFLLSLPMPFYRSNLRKVFPNNATLRFCIPYHWRSV
GHQVFQYTFETIMGCLVPFSLINTCYSSVICRLQSAMFHRRGKGSRLILMIICTFAVFWL
PYHIVNIIEVIPSTSEVRGRQPKML
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccaacagcaccgccgccttctctctgcccgtcagcacctcagccaaagtcggc
atcgccatcctgaccttggcctttgcgctgggcttccccgggaacctctttgtggtgtgg
tcggtggtttgtcgtgtccaaaagcgctcagtgacgtgcttgctggtactcaacctggcc
gttgccgacgccttggtgctgctcacgtcgcccatattcctgcgttaccttgctgggggg
cagggatgggagtttggctcagcggcctgcaagctggtgcactacctgtgcaatgtcaac
atgtacgtctccatctacctcatctgcctgatgagcatggatcgctggctggccgtctcc
cggcctttcatgtcccagaagatgcggactaagcgctccctgctgtttctcctcctggga
gtctggatcatggcgttcctgctgtctcttccgatgcccttctaccgcagcaacctgagg
aaagtgttcccgaacaatgccacgttgagattttgcataccgtaccactggcgaagtgtc
ggtcatcaggtctttcagtacaccttcgagaccatcatgggctgcctggtgcccttctcc
ctcatcaacacgtgctactcgtccgtgatctgccgcctccagagcgccatgttccatcgg
cggggcaaaggcagccggctgatcctgatgatcatctgtacctttgccgttttctggctg
ccgtatcacatcgtcaatatcatcgaggtgattccgtcaacctccgaggtcaggggtcgg
caacccaaaatgttg

DBGET integrated database retrieval system