KEGG   Hippocampus comes (tiger tail seahorse): 109510155Help
Entry
109510155         CDS       T04969                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hcq01002]
    109510155
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109510155
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109510155
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109510155
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109510155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Peptidase_S9 Peptidase_S15 Acyl_transf_2 FSH1 Thioesterase DLH
Motif
Other DBs
NCBI-GeneID: 109510155
NCBI-ProteinID: XP_019715839
Position
Unknown
AA seq 378 aa AA seqDB search
MRKRRTSSTTVEQEEGDEALEDAPEETSRPAAYSMSDMKTFAGPRRRGPVSKVKRAAKWL
LMLYVCVPFVVKLCPSIQAKLVFLNFVRVPFFLDLKRPSDVGLDHTLNFYLQPQQKLRIG
VWHTVPADIWREAGGQSQEWFESTLSSAHPAILYLHGNTGTRGGDHRVELYKVLSSSGYH
VVTFDYRGWGDSDGSPSEGGMTADALFVYQWLKERRGQGRVYIWGHSLGTGVATNLVRRL
CDGGSPPDALILESPFTNIREEARSHPFATVYRYLPGFDWFFLDAITANDIRFANDDNVN
HISCPVLILHAEDDHVVPFHLGKQLYEVAKRSRSLSGHKVEFVAFPSSLAYRHKLIYSSP
QLPRILRDFLDTPPPKKE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcggagaacgtcgtcgacgaccgtggagcaagaggagggagacgaggcgctc
gaggacgcccccgaggagacatcgcggcccgcggcctattctatgtccgacatgaagacc
ttcgccgggccacgcaggcgtggccccgtgtccaaggtgaagcgcgcggccaagtggctg
ctgatgctctacgtgtgcgtgcccttcgtcgtcaagctgtgcccgtccattcaggccaaa
ctggtcttcctcaacttcgtgagggtccccttcttcctcgatctcaaacgaccttcggac
gtgggccttgaccacacgctcaacttctacctgcagccgcaacagaagctccgcatcgga
gtgtggcacacggttcctgcagacatatggagagaagctggcggccaaagccaagaatgg
tttgaatcgacattaagctccgcccacccagccatcctctatctccatggaaacacaggg
accagaggcggcgaccatcgagtcgagctgtacaaggtcctcagctcatccggctaccac
gtggtcaccttcgattatcgaggctggggcgactcggatgggtcgccgtcagagggcggc
atgacggcggacgctctcttcgtgtaccagtggctgaaggagaggcggggtcaaggccga
gtgtacatttggggacactcgctgggaacgggcgtcgccaccaacctggtcaggcgattg
tgcgacggaggaagtcccccggacgctttgatcctggagagtcctttcaccaacatccgc
gaggaggccaggagtcaccccttcgccacggtgtacaggtacttgcctggctttgactgg
ttcttcctggacgccatcaccgccaacgacatccgcttcgccaacgacgacaatgtgaat
cacatctcgtgccccgtgttgattctccacgccgaggacgaccacgtggttcctttccac
ctgggcaagcagctgtacgaggtggcaaagcgctccagaagcctgagcggacataaagtg
gagtttgtggccttcccgtcgtcgttggcctacaggcacaagctcatctacagcagcccc
cagctgccccgcatcctcagggatttcctggacacaccccctcccaagaaagagtaa

DBGET integrated database retrieval system