KEGG   Hippocampus comes (tiger tail seahorse): 109510195Help
Entry
109510195         CDS       T04969                                 

Definition
(RefSeq) adenylosuccinate synthetase isozyme 2-like isoform X1
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq00250  Alanine, aspartate and glutamate metabolism
hcq01100  Metabolic pathways
Module
hcq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109510195
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109510195
Enzymes [BR:hcq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     109510195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt Spore_YpjB
Motif
Other DBs
NCBI-GeneID: 109510195
NCBI-ProteinID: XP_019715899
UniProt: A0A3Q3D393
Position
Unknown
AA seq 448 aa AA seqDB search
MSGSGCQEPATRPGRPPVGNQVTVVLGAQWGDEGKGKVVDLLAQDADMVCRCQGGNNAGH
TVVVDSVEYDFHLLPSGIIHPEVTAFIGNGVVIHLPGLFEEAAKNERKGKSLKDWEKRLI
ISDRAHIVFDFHQAVDGIQEQLRQEQAGRNLGTTKKGIGPVYSTKAARSGLRICDLLADF
KDFSDRYKVLARRYQAMYPSLHIDMEGELVKLKAYVEQIKPMVRDGVHYMYEALHGPPKN
ILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGA
FPSEQNNDVGELLQTRGKEVGVTTGRKRRCGWLDLVLIKYAHMINGFTALALTKLDILDV
LPEIKVGVAYKVDGQMIPHFPANQEVLLHVEVQYETLPGWNSNTTAARSFDDLPENARKY
VRFVEERVGVPVKWIGVGKSRESMIQRF
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaagtgggtgccaggagccggcgacgcggcccggtagaccgccggtgggcaac
caagtgacggtggtgctgggcgcacagtggggtgacgaggggaagggcaaagttgtggac
ctgctggctcaagacgccgacatggtgtgcagatgtcagggcgggaacaacgcaggacac
acggtggtggtggactcagtggagtacgactttcacctcctccccagcggcatcattcac
cccgaagtcaccgccttcatcggtaacggcgtcgtgatccacctgccgggcctgttcgaa
gaggccgcaaagaacgagcgcaaaggcaaaagtctgaaggactgggagaaaaggttgatc
atctcggacagggcgcacatcgtgtttgatttccaccaagccgtggatggcattcaggag
cagctgaggcaagagcaagcaggcaggaatctggggacgacaaagaagggcatcggtccg
gtgtattccaccaaagcggcgcgcagcggcctcaggatctgcgacctgctggccgacttc
aaagacttctccgacaggtataaagtcttggctcggcggtaccaagccatgtaccccagt
ctgcatatagacatggagggtgagctggtcaaattaaaggcttacgtggagcagatcaag
ccaatggtgagggatggcgttcactacatgtacgaggctcttcacgggcctccaaagaac
atcctggtggagggagccaacgcggcactgctggacatcgatttcgggacgtatccgttc
gtgacatcatccaactgcacggtgggcggggtgtgcacgggcctcggcatgccgccgcag
aacgtcggcgaggtttacggcgtggtcaaggcctacaccacccgggtgggcatcggcgcc
ttcccctccgagcagaacaacgacgtcggcgagctgctgcagacccgcggcaaggaggtc
ggggtgaccacggggaggaagcggcgctgcggttggctcgacctggtgctcatcaaatac
gcgcacatgatcaacggcttcacggctttagcactcaccaaactggacatacttgacgtc
ctcccggagatcaaagtgggggtggcatataaagttgacggccaaatgataccgcacttc
ccagccaatcaggaggtgctgctgcacgtggaggtccaatacgagacgctgccaggctgg
aacagtaacacgacggctgccaggagcttcgacgatctcccggagaacgcccggaaatac
gtacgcttcgtggaggagcgcgtcggcgtgcccgtcaaatggatcggcgtgggcaagtct
cgggagtccatgatccagcgcttctag

DBGET integrated database retrieval system