KEGG   Hippocampus comes (tiger tail seahorse): 109511350Help
Entry
109511350         CDS       T04969                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04060  Cytokine-cytokine receptor interaction
hcq04068  FoxO signaling pathway
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109511350
   04068 FoxO signaling pathway
    109511350
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109511350
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109511350
   04217 Necroptosis
    109511350
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109511350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109511350
   04052 Cytokines and growth factors [BR:hcq04052]
    109511350
   04090 CD molecules [BR:hcq04090]
    109511350
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109511350
Cytokines and growth factors [BR:hcq04052]
 Cytokines
  Tumor necrosis fators
   109511350
CD molecules [BR:hcq04090]
 Proteins
  109511350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF C1q
Motif
Other DBs
NCBI-GeneID: 109511350
NCBI-ProteinID: XP_019717991
Position
Unknown
AA seq 248 aa AA seqDB search
MRHPRSVYLVDSHAAAAPPLPPRAGRARRCTGLAQTILFMLVSVALTGLILEALLIFYLH
SNHFEQTPSTSHSKLTAEKKASPHISTHHSSVSKPLTRLLEKKRSPHTCTPDSKPVARLI
GGKDATHGKSVVGWSLISGNLLCGMDYKNGSLLIRREGFYFVYSKLSFHKSATTFHHTVV
KRTRRHPGGTVPLLQAREFSSADKNNGNTFLGGVFHLLKDDALFVKVSDTSKIVQVIAHE
NVFGAFMI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacccacggtcagtctacttggtcgacagccacgccgccgccgcccctccgctg
ccgccccgagcgggccgggcccgacggtgcactgggctggctcagacgattctcttcatg
ctggtgagcgtggctctgaccgggctcatcctggaggcgctgctcatcttctacctgcat
tcaaatcatttcgagcagacgccgtcaacgtcgcattccaagttgactgcagaaaaaaag
gcatctccccacatttccactcatcatagctctgtttccaaacccctcacacggctgttg
gagaaaaaacgatctccacatacttgcactcctgattccaaaccggtcgcacgcctgatt
ggtggcaaagatgcaactcacggcaaaagcgtagttggctggagccttatttcgggcaat
cttctctgcggcatggactacaagaacggaagtctgctgatccgccgagaaggcttctac
tttgtctactccaaattgtccttccacaaaagcgccaccaccttccaccacaccgtcgtg
aagcgcactcgccggcaccccggcggcactgtccccctcttgcaggccagggaattttct
tctgcagacaagaacaacggcaacactttcctcggcggggtctttcacctgctcaaagat
gacgctctgtttgtcaaagtcagcgacacttccaaaatagtgcaggtcatcgctcacgag
aacgtctttggtgcatttatgatataa

DBGET integrated database retrieval system