KEGG   Hippocampus comes (tiger tail seahorse): 109511501Help
Entry
109511501         CDS       T04969                                 

Gene name
gucy1b3
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq01100  Metabolic pathways
hcq04270  Vascular smooth muscle contraction
hcq04540  Gap junction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109511501 (gucy1b3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109511501 (gucy1b3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109511501 (gucy1b3)
Enzymes [BR:hcq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109511501 (gucy1b3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 109511501
NCBI-ProteinID: XP_019718208
Position
Unknown
AA seq 610 aa AA seqDB search
MYGFVNHALELLVLRNYGPEVWEDIKREAQLDIEGQFLVRIIYDDTKTYDLVAAASKVLK
INAGEILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSF
RCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKMIQPKSEECDHIKFL
IEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIYRVL
PQLQPGACILPSVFSLVRPHIDFSYHGILSHINTVFVLRSKEGLLNVETVENEDELTGVE
ISCLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRKNPYVYKVETVGDKYM
TVSGLPEPCTHHAKSICHLALDMLEIAGQVKVDDEPVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSPENADPQFHLAYRGPVTMKGKKEPMK
VWFLSRQEVH
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtacggctttgtgaatcacgccttggagctgctcgttttgaggaattacggaccggaa
gtgtgggaagacatcaagagggaagcgcaactcgacatcgagggtcagttcctcgttcgg
atcatttacgatgacaccaaaacgtatgacctggtcgccgctgccagcaaagtactcaag
attaatgcaggagaaatcctgcagatgttcgggaagatgttctttgagttttgccaagag
tcgggatacgacaccattttgcgggtgctggggtcaaacgtgcgcgaattccttcagaat
ttggacgcccttcacgatcacctggggaccatctatcccggtatgagggctccctcgttc
cgctgcacggatgcagagaagggcaacaatctaatcctgcactactactctgagcgagaa
ggcctgcaggacatcgtgattggcatcattaaaacggtcgcacaacaaatccatggcaca
gagatagagatgaagatgatccaacccaaaagcgaagagtgcgaccacatcaagttcctg
atcgaggaaaaggactcggaggaagaggctttctacgaggacctggacggcttcgaggag
aacggcacccaggagacgcgcatcagtccgtacaccttttgcaaggccttcccctttcac
ctgatgttcgacaaagacctgatgctcacgcagtgcggcaacgccatttaccgggtgctg
cctcagctccaacctggcgcctgcatcctcccgtcggttttctccctggtccgcccacac
attgacttcagctaccatggcattctttcccacatcaacactgtctttgtcctgcgaagc
aaggagggtctgctaaacgtggagacggtggagaatgaggacgagctgacgggggtggag
atcagctgtctacggttaaaaggacagatgatttatttgcccgaagccgagaacatcctc
tttctttgctcgcccagtgtgatgaacctggacgacctgacgcgacgaggcttgtacctg
agcgacatcccgctgcacgatgccacacgagacctggtgctgttgggcgagcagtttcgt
gaagagtacaagctgacccaggagctggagatcctcaccgaccgcctgcagcacacactc
cgggccctggaggacgagaaaaagaagacggacagactgctgtactccgtcctgcctccg
tccgtagccaacgaactgcgacacaagcggccagtcccggccaagcgctacgacaatgtc
accattcttttcagcggcatcgttggcttcaacgccttctgtagcaagcatgcctccgcc
gagggcgccatcaagattgtcaacctgctcaatgacgtttacacccgattcgacatcttg
accgactcgcgaaagaacccatacgtgtacaaggtggagacggtgggcgacaagtacatg
acggtgagcggcctgcccgagccgtgcacgcaccacgccaagtccatttgccatcttgcg
ctcgacatgttggaaatcgcgggacaagtcaaagtggacgacgagcccgtacagattacc
atcgggatccacacgggagaggtggtgacaggggtgattggccagagaatgccccggtac
tgcctcttcggcaacacggtcaacctcacaagccgcacggaaaccactggtgaaaagggc
aaaatcaatgtttcagaatatacatacaggtgcttgcagtcccccgagaacgcggaccct
cagttccatctggcttacagaggccccgtcaccatgaaagggaagaaggagcccatgaag
gtgtggttcctgtccagacaggaagtccactga

DBGET integrated database retrieval system