KEGG   Hippocampus comes (tiger tail seahorse): 109511597
Entry
109511597         CDS       T04969                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109511597 (adamts13)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     109511597 (adamts13)
Peptidases and inhibitors [BR:hcq01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   109511597 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN TSP1_spondin Reprolysin_3 Reprolysin_4 Reprolysin_5 CUB Reprolysin_2 ADAM_spacer1
Other DBs
NCBI-GeneID: 109511597
NCBI-ProteinID: XP_019718359
Position
Unknown
AA seq 1392 aa
MCSGRGARMMFMTLLCLLLLLPGFRTLMRYPSGELFDYSSRQRDVVSHTLSSGVSVRGQP
RRPTPMPDVTHLELLVVVGSDVQRVHNQDTERYILTNLNIASELLRDMTLGANMRVHLVR
MIILSEPESEIRMSTNITSSLRSVCDWGSRLNPSNDTDPLHADLLLYITRYDLVLPDGNK
QVRGVTQLGGACSSEWSCVITEDTGFDLGITIAHEIAHSFGINHDGVGNTCSRNGFMMAS
DGGYNSVDLTWSPCSRHQLLTFFSEGNAECVKDLPAVESSLQDWKPGLYYGVDDQCRIAF
GSNARSCSFTDPDMPMCRVLSCHTNTNDDNSCKRLLVPLLDGTQCAPDQWCLKGRCVSPD
QLSTSAVVHGSWSGWSGFSHCSRTCGGGIVHRTRQCNNPRPAFGGKDCVGIDIEAELCNR
QPCERTQLDFMAEQCSQTDFQPLYLHPHQASFYTWIPAVGFSQGDEQCRYMCQSKGEAFI
VSRGSQFADGTRCEADGQLPPGSIAACLQGKCLLFGCDGVLHSGKVRDVCGLCGGDGSSC
TLTTESYTGDQAREYTTFLSVPLNATQVYIINRAPLFTHMAVLYGDQYIVSGTGRMALNM
THPSPLDENWLEYRLHLTPDLLPEKEELLLPGPVQVQIDIQVYRNYGKEYGEKTNPNISY
QFYVPNDHSDLTEIKLEGIWSLTTTPCSVSCGLGVQKHQYVCVDKDTKTHLEGHHCYASP
PPLPQHTSCQLPACPPRWITGNFGSCSSSCGRGERIRSVTCVQKHGADVVRVRDSDCPAD
SAPNAVEKCHLPLCPARWHVSEAGDCSAVCGPGEMKRNVSCVRQEDGQEVEVDERFCTNQ
IRPARSVPCVVDVCPIGWDVTREDLPALKSGLMPRSRQAPVFVWSPVIIQCSKTCGNGTM
QVWFSCVDHDTTWMVPDFHCDPSTKPPPKSENCNTLPCPPMWRSKPGICSTTCGGGVANT
VLYCAQEKDGEEKVLEDSECRDLPKPTAVVPCNTHNCPARWKVQSTSPCSLSCNLGVAHR
NVSCVQFVQGKETVVLEERCHTSVKPASTVPCLVQVCTFRWEAKPWSQCSVSCGYGIQSR
TVSCMGPSKPEPLSPPLCMHIPKPITIQGCSMDSCTDLPPSSVVTPAMHPALEDSHPSHT
PYTIRKQHRMGNLPLSPSKAVTILQSRRAASPSTKPHPCGELLLQESDTVDLSNITGSCM
VAIGRPLDEVIHVKVESSSLNCRKREYALFFDRLALVRKCEQAGGSTLTTRTNVLLVRQN
LLTSGNGIVFTYSSQRNTKKSHRQNCDKQLFSSSGVFENPTNSDTNHTCRVLINAPPSVK
IRIQAVHIGLVFNATNSHSSYIMIRDTDMLKTKVFKGPQLFQWHSSGNMAEVEFHGDYQR
TAGSFRAEYSFV
NT seq 4179 nt   +upstreamnt  +downstreamnt
atgtgctcaggaaggggagccagaatgatgtttatgactctgctctgtctgctgctactc
ctgcctggcttcagaactctaatgagatatccatcgggcgagctttttgattattctagc
agacaaagagatgtggtttcacatactctttcttctggagtctcagtgagaggtcagcct
cgtcggccaactccgatgcctgatgtcacgcacttggaactactggtagtggttggatct
gatgtccagcgggtccacaaccaggataccgaacgctacatactcaccaacctcaacatc
gcctcagaactgttgagggacatgactttaggagccaacatgagggtgcatctggttcgc
atgatcatcctgtccgaaccagagtcagagatccgaatgtcaacaaacatcacctcttct
ctccgaagtgtgtgcgactggggctcccgcttaaatccgtctaatgatacggacccactg
catgctgatctcctcttgtacattacaaggtatgacctggtgttgcctgatggaaacaag
caggtcaggggagtgacacagctgggaggtgcttgttccagtgagtggagctgtgtgatc
acagaggacactggatttgaccttgggatcactattgctcatgagattgcacacagtttt
ggcatcaatcatgatggagtggggaacacatgcagtcggaatggcttcatgatggcatct
gatggcggctacaacagtgtggatctgacctggtcgccctgtagcagacatcagctgctc
acttttttcagcgaaggcaatgctgagtgcgtaaaggatctaccagccgttgaaagctcc
ctacaggactggaagcctggcctctattatggtgtggatgaccagtgtcgaatagctttt
ggaagtaatgcaagaagctgctcatttacagatccagatatgccaatgtgtagggttcta
tcttgtcacacgaacacaaatgatgacaactcctgcaaacgtcttctagtacctctgctg
gacgggacccaatgtgcacctgatcaatggtgtttgaagggacgttgcgtatccccggac
cagctcagcacctcggcagtggtgcatggctcttggtccggctggtctgggttctcccac
tgctcacgaacatgtggcggcggaatcgttcaccgcacgcgccaatgtaacaacccaaga
cccgcttttgggggaaaggattgtgtggggatagatattgaggctgaactttgtaacagg
cagccatgtgaacgcacccagctggatttcatggctgagcaatgttcccaaactgatttc
caaccgctataccttcatccacaccaggcctccttctacacctggatccctgcagtgggc
ttctcacaaggtgatgagcaatgcagatacatgtgccagtccaagggagaagccttcatc
gtgagccgtggatctcagtttgctgacgggacacggtgcgaagctgatggccaacttcct
cctggctcaatagctgcttgtctgcaagggaaatgtctgctcttcggctgcgacggcgtg
ttgcactctgggaaagtgagagatgtgtgtggtttgtgcggtggggatggctcttcctgc
acactgaccaccgaatcttacactggagatcaggcaagagagtacaccactttcttgtct
gtgccattgaatgctacgcaggtttatatcatcaacagggcgcctttattcactcacatg
gctgtattatatggagatcaatatattgtctccgggactggtagaatggcattaaatatg
acccatccctccccactggatgaaaactggttagagtaccgcctacatctgactcctgac
ctcttgccggagaaggaagagctactgcttcctggaccagtacaagtgcagatcgacata
caggtttatcgcaactatggaaaagaatatggagagaaaacaaaccccaacattagttat
cagttttatgttccaaatgatcacagtgacttgacagaaattaaacttgaaggcatatgg
agccttacgacaacaccctgctctgtctcctgtggcttaggtgtgcagaagcatcagtat
gtatgtgtggacaaagacacgaaaacacatctggagggacaccattgttatgcgtctcct
ccacctttaccacagcatacatcctgtcagctcccagcctgcccaccaagatggatcacg
ggaaattttggatcctgtagctcttcctgtggtagaggagagagaatacgttctgtaaca
tgtgtacagaaacatggcgcggatgttgtgagggttcgggattcagactgtccagctgat
tcagctccgaatgctgttgaaaaatgtcatcttccactttgtcctgccaggtggcatgtg
tcagaggcaggggactgttcagcggtgtgcgggccaggagaaatgaaaagaaacgtgtca
tgtgtacggcaagaagacggccaagaagttgaagttgatgaaagattctgcacaaatcaa
ataagacctgctagatctgtgccctgtgtagtggacgtctgtcccattgggtgggacgta
acgcgggaggacctgcctgctttaaagtctggcttgatgccacgctcgagacaagccccc
gtgtttgtgtggagtccggttatcattcagtgctcaaagacatgtggcaatggaacgatg
caagtgtggttctcttgtgtggaccatgacaccacatggatggtacccgatttccactgt
gacccttcaaccaaacctccgccaaaatctgagaactgtaatacactcccttgccctcct
atgtggcgatctaagccaggcatctgcagcacaacgtgtggcggaggggttgccaacaca
gtgctgtactgtgctcaggagaaagatggagaagagaaggtactggaggattctgagtgc
agggaccttccaaaacctacagcagtggtgccatgtaacacccacaactgcccggcaagg
tggaaggttcagagtacgtcgccttgctctctatcctgtaacctgggtgtagctcacagg
aatgtgtcctgtgtccagtttgtccaagggaaggaaactgtggtgctggaagagagatgt
catacatcagtcaaacctgctagcacggtgccatgcctcgtacaggtgtgcacctttcgg
tgggaagcaaagccatggagccagtgttcagtgtcctgtggatatggcatccagtccaga
acagtgtcatgcatgggcccttcgaagccagaacccctcagcccaccactgtgcatgcac
atacccaagccgatcaccatccagggctgcagcatggacagctgcacggatctgccaccg
agttcagtagtcactccagctatgcatcctgctttagaggattctcacccgtctcacact
ccatatacaattagaaaacagcaccgcatgggtaatcttcctctgagtccatctaaggca
gtcaccatcctgcagtccaggagagcagccagtccttcaactaaaccccatccatgtgga
gagctgctcctgcaagaatccgacacagtggacttgagcaacattactggttcctgcatg
gtggccattggccggcccctggatgaggtcattcacgtcaaagtcgagtcaagttcctta
aactgcagaaagagagaatatgctctattttttgaccgactggcgcttgtgaggaagtgc
gagcaggcaggaggcagcacgctgaccaccagaaccaacgtccttcttgtgcgccagaat
ctgctcacttcagggaatggcatcgtgttcacctacagctcacagagaaatacgaaaaag
agccaccgtcaaaattgtgacaagcagctgttttcctccagcggggtatttgagaatcca
acaaactccgacacgaaccacacctgtcgggtgctgatcaatgcccctccctcggtgaag
ataagaatccaagcagtgcacatcggattggtattcaacgctacaaattcacactcttca
tacattatgatccgggacacggacatgctgaagaccaaagtgtttaaaggcccacaactg
tttcaatggcactcctctggaaatatggccgaggttgaattccatggagattaccagcgt
acggcgggaagcttcagagcggaatattcttttgtataa

DBGET integrated database retrieval system