KEGG   Hippocampus comes (tiger tail seahorse): 109512661Help
Entry
109512661         CDS       T04969                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00020  Citrate cycle (TCA cycle)
hcq00480  Glutathione metabolism
hcq01100  Metabolic pathways
hcq01200  Carbon metabolism
hcq01210  2-Oxocarboxylic acid metabolism
hcq01230  Biosynthesis of amino acids
hcq04146  Peroxisome
Module
hcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hcq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109512661
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109512661
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109512661
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     109512661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 109512661
NCBI-ProteinID: XP_019720119
Position
Unknown
AA seq 245 aa AA seqDB search
MAAKIKAGSVVEMQGDEMTRVIWELIKQKLIFPYLELDLHSYDLGMENRDATDDRVTVEA
AEAVNRVPETPRNKSLLCNFGWWISKALTIPSTCSPQYKATDFVVPGPGKVEMIYTPVSG
EQVKFVVHNFEGTGGVALGMYNTDKSIRDFAHSSFQMALVKCWPLYLSTKNTILKKYDGR
FKDIFQEIYEKEYRAQFEAKGIWYEHRLIDDMVAQAMKSDGGFIWACKNYDGDVQSDSVA
QGWYD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaaatcaaagccgggtctgtggtggagatgcagggtgacgaaatgacccgg
gtcatctgggagcttattaagcagaagctcatcttcccctacctggaacttgacttgcac
agttatgacctcggaatggagaaccgtgacgctacggacgaccgtgtgacggtggaggca
gctgaggcggttaacagagttccagaaaccccccgcaataagtctctgctctgtaacttt
gggtggtggatttctaaagcattgacaattccttcaacatgttccccacagtacaaagcc
accgattttgtggttcccggaccgggcaaagtggagatgatctacacgcctgtaagcgga
gagcaggtcaagttcgtcgtccacaattttgaaggcactggcggtgttgcattggggatg
tacaatacggacaaatccatcagggactttgctcacagctcctttcaaatggctctggtg
aaatgctggcctctgtacctcagcaccaagaacaccattttgaagaagtatgatggacga
ttcaaggacattttccaggagatctatgagaaggaataccgtgctcagtttgaggccaaa
ggtatttggtacgagcaccgtctgattgacgacatggtggcccaggcaatgaagtcagat
ggaggcttcatttgggcctgcaagaactacgatggagatgtacaatccgactcagtggct
caaggttggtacgattga

DBGET integrated database retrieval system