KEGG   Hippocampus comes (tiger tail seahorse): 109512730Help
Entry
109512730         CDS       T04969                                 

Gene name
wnk4
Definition
(RefSeq) serine/threonine-protein kinase WNK4 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109512730 (wnk4)
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109512730 (wnk4)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109512730 (wnk4)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: Other
  Wnk family
   109512730 (wnk4)
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109512730 (wnk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109512730
NCBI-ProteinID: XP_019720241
Position
Unknown
AA seq 1360 aa AA seqDB search
MSHAQVEIAGCGFPGLQPHGLGMRRNSYGLHKISVDVDSPLFSGALSKALSWSAENILSL
PESRAEEEEDEEKPRDDTPPCSPLSDVAGSPGESDSEPAQGKGRWTSSRVNFDPRSEEEK
EDVETKAVATSPDGRYLKFNIEIGRGSFKTVYKGLDTETTVEVAWCELQTRKLTKAERQR
FSEEVEMLKGLQHPNIVRFHDSWKSTVKGHKCIILVTELMTSGTLKTYLKRFKEMKPKLL
QRWSRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKSASFAKSVI
GTPEFMAPEMYEEKYDEAVDVYAFGMCILEMATSEYPYSECQNAAQIYRKVTSGIKPDSF
YNVKVPELKEIIEGCIRMNNDERYTIQDLLEHPFFQENHGVHVELAEEDDALKSGLKLWL
RMDDTKKLHGKYKDNNAIEFLFELYKDVPEEVAQEMVVLGFVCEADFKLVAKAIRDRVTA
IKRQREKLRRQAEERRPRSSSPRVGDIAAGESPSPPAPLPSPLLSPVTSSADSGVSSGCP
AETEEPEADQPFHIRHNSLSSANSDCETDCDLSSPGLQDPLEATPPASYAHSSTTNGLPI
PALRFPSSIAVSNKMESVKPGSPNGFNSPGDSYASDVTSGLSDGYEGVPEKSEKTVARRT
AAKLFRRRVRSRLRITGLSDKVDRVVECQLQTHNDKMVTFKFDLDGDNPDDIAAVMVHNE
FILPSEKEGFIYRMGDIIKRAEALMAKEQPVHPCEQRPPQPAFHSEANPLSSSQPDLYSQ
SLPRTHFSSLPDFAVANPRAEEGTSPPCADGDVFAPNATSPGRPLVRSQSFHNAPGSPLA
YHHTASLLPHCHMPYMGNFPFQYNARPASPKPRATAVGGLHPPLARASSSPTFPSVPSPV
PPGSPNLLNDRESPSGASPAPPHPCMWPPQSQPLFSLANVISMAMSMAQSFIPPAQQGMP
SYGDFHPQSAFQYPPCYQTPTMEVPYPTNVYPSSGNTPPMDVFPQCWHDTSPATPPNTPL
QQAGSPASPRPPQEDLGPFLGQVPVLSQVPSSTSLSDLSPSPTGSPESTLSSISTLSELN
AGSPTAQKVSPLSPSGGPAAPVTVGRFHVSPSADDPVVASLPQGDTSSTEEGHGQPEKSL
GASIPMREEEEEEEVAEERPRVRRRGRRRAHSLSLIGTSADSGLSVTTPEAEGRLWDGAA
GSPQYGNALHHLWTMTYNHNASYMSSDDSDSDDDKDMLDELQELREKHLSEVQELQAAQK
REIEDLYEKMGKVPPPGIVSPAAMLSSRQRRLSKGAGGLPPSRRNSLQRLDMQPIQGIIR
RNSLGGSSSSSQDKHSKGVTFASDISRMNEQSLNNPDYLI
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgcccaggtggagatcgccggatgcggcttcccaggcttgcagccacatggt
ctgggcatgcgacgcaattcgtacggcttgcataagatcagcgtggatgtggactcgcct
ctcttcagcggcgccctctccaaagcgctctcgtggtcagcagagaacatcctcagcctg
cccgagtcccgagccgaagaggaggaggatgaggagaaaccccgtgacgacaccccccct
tgcagccctctttccgatgtcgccggctcgcccggcgagtctgacagtgagccggcgcag
gggaaagggcggtggacatcgtctcgggtgaactttgacccgcggtcggaagaggaaaag
gaggacgtggagaccaaagcggtggcaacgtctcctgacggccgctacctcaagttcaac
atcgagatcgggaggggttccttcaagaccgtctacaagggcctcgacacggagaccacg
gtggaggtggcctggtgcgagcttcagactcgtaagctgaccaaggcagagcggcagcgc
ttcagcgaggaggtggagatgctgaagggcctccagcatcccaacatcgtgcgctttcac
gactcgtggaagtcgacggtgaagggccacaagtgcatcatcctggtgaccgagctcatg
acatccggcacgctcaagacctatctgaaaaggttcaaggagatgaagccgaagctgctg
caacgctggagccgtcaaatcctgaaggggctccatttcctgcacacgcgcacgccgccc
atcatccaccgagacctcaagtgcgacaacatatttatcaccgggcccaccggctccgtc
aagatcggtgacctcggactggccacgctcaagagcgcctcttttgccaaaagtgtgatc
ggaacgcccgagttcatggcccccgagatgtacgaggagaaatacgacgaggcggtggac
gtctacgccttcggcatgtgcatcctggaaatggccacctccgagtatccctactctgaa
tgtcaaaatgctgcacagatttaccgcaaagtcaccagcggcataaaacccgacagcttc
tacaacgtgaaagtgccggagctcaaagagatcatcgaaggctgcattcgcatgaacaac
gatgaaaggtataccatccaggatctgctggagcaccccttcttccaggagaaccacggc
gtgcacgtggagctggccgaggaggacgacgcgctcaagtctggcctgaagctgtggctg
cgcatggacgacaccaagaaactccacggaaagtacaaggacaacaacgccatcgagttc
ctctttgaattgtacaaagacgtccccgaagaggtggcgcaggagatggtggtgctgggc
ttcgtgtgcgaggccgacttcaagctagtggccaaagccatccgggaccgcgtgacggcc
atcaagcgccaacgggaaaagctgaggcggcaggccgaggagcggaggccgcgttcgtcc
tccccgcgagtcggcgacatcgcggccggcgaatccccctcgccgccggcccccttgcct
tcccccctcctgtcccccgtcaccagctcggccgactccggcgtcagctccggctgcccc
gcagagacggaagagcccgaggccgaccagccctttcacatccgccacaacagcctctcc
tcggctaattctgactgcgagacggactgcgacctgagctcccccggccttcaagacccc
ctggaggccacaccccccgcctcctacgcccactcctcgaccacaaacggcctgcccatc
ccggcgcttcgtttcccttcgagcattgccgtatccaacaaaatggaaagcgtcaagcca
ggatctccgaatggcttcaactctcccggggacagctacgcctctgacgtgacctcgggc
ctgagcgacggttacgagggagtgccggagaaaagcgagaaaacggtggccaggcggacc
gccgccaagcttttcaggaggcgggtacgctccaggctgcgcatcaccgggctatctgac
aaagtcgaccgggtggtggagtgtcagctgcagacacacaacgacaagatggtgacgttc
aagttcgacctggacggagacaacccggatgacattgccgccgtcatggtgcacaacgag
ttcatcctgccgtcggagaaggagggcttcatctaccgaatgggcgatatcatcaagcgg
gcggaggcgctcatggccaaagagcagccggtgcacccctgtgagcagcgtcctcctcag
cctgccttccacagcgaagccaacccgctctcttcctcgcagccggatctgtacagtcag
agcctcccacgaactcacttctcctccctgcccgacttcgctgtggctaatccgcgcgct
gaggaaggcacctcacctccgtgcgccgacggcgacgtcttcgccccaaacgcgacttcg
cccgggcgaccgctcgtccgctcgcagtcgttccacaacgcgccaggctctcctctcgct
taccaccacaccgcctccctcctgccccactgccacatgccctacatgggcaacttcccg
ttccagtacaatgccaggccggcttcccctaaaccgagggccacggcggtcggcggcctc
catccccccctcgcccgcgcgtccagtagccccacttttccatccgtcccttccccggta
ccgccgggctccccgaacctcttgaatgacagagagagcccatccggggcgtcgcccgcg
cccccgcatccctgtatgtggcccccgcagagccagccgctgttctcgctggccaacgtc
atctccatggcgatgagcatggcgcagtcgttcatccctccagcccagcagggaatgccc
tcctacggggacttccacccgcagtcggcgttccagtaccccccttgctaccagaccccc
acaatggaggtgccgtaccccacaaacgtctacccgagctctgggaacacgccaccgatg
gatgtattccctcaatgttggcatgacacgtcccctgctaccccgccaaacacgccactg
caacaggccggatctcccgcttcacccagaccccctcaggaggacctcggacctttcctg
ggccaagttccggtcctatctcaagtgcccagttcgacctcgttgtcggatctgtcaccc
tcgccaacaggcagtccggagagcaccttatcatccatcagcactctgtccgaactgaac
gccggaagtccgacggcccaaaaagtgtcgccattgagcccctcgggaggtccggccgct
cctgtgacggtgggccgtttccatgtgtcgcccagcgccgacgacccggtcgttgcctcg
ctgccacaaggggacacaagcagcaccgaagaagggcacggccaacccgagaaaagcctg
ggtgcctccatccccatgagggaggaggaagaggaggaggaggtggcggaggagcgcccg
agggtgaggagacgcgggcggaggcgggcgcacagcctcagcctgataggcacgtccgcg
gacagcgggctgtcggtgacgacgcccgaggcagaaggccggctgtgggacggcgcggcc
ggcagcccgcagtacggcaacgcacttcaccacctgtggaccatgacctacaatcacaac
gcttcctacatgagcagcgatgactcggacagcgacgacgacaaagacatgctggatgag
ctccaggagctccgagagaaacatctgtctgaggttcaggaacttcaagcagctcagaag
cgggagatcgaggatttgtatgaaaagatgggcaaagtccccccaccgggcatcgtttcc
ccggccgctatgttgtccagccgtcaacgtcgcttgtccaagggtgcggggggcttgccg
ccgtcacgccggaacagcctccagcgcttggacatgcagcccatccaagggatcatcaga
agaaactctttgggaggaagcagcagcagctcccaggacaaacacagcaaaggcgtcacc
ttcgcctcagacattagcagaatgaacgagcaatcgttgaataatccggactacctcatc
tga

DBGET integrated database retrieval system