KEGG   Hippocampus comes (tiger tail seahorse): 109512925Help
Entry
109512925         CDS       T04969                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109512925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109512925
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109512925
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   109512925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 Kdo APH FTA2 YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 109512925
NCBI-ProteinID: XP_019720591
Position
Unknown
AA seq 466 aa AA seqDB search
MHHPCHACVCTRWESHSRPTAATLLTSQPRPAADMGRQEADNLWKKDTQDIQEIFDFMEE
LGSGAFSEVFMVREKKTGRTFAMKCVKKKQTRDLTLENEIAVLRRIQHENVVGMEDFYES
QTHFYLVMQLVSGGELFDRILDRGVYSEMDASRVIQQVLHAVSYLHQNGIVHRDLKPENI
LYYSPEENSKIMISDFGLSKMVDKGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIT
YILLCGYPPFYEESETRLFSKIMKAQYEFDSPFWDDISESAKDFIRNMMQKNPLMRYTTE
QALRHPWIIGKTARSQDIYYSVSVQIQKNFAKSKWKQAFNAAVAINHMKKLQLAHAAAEQ
VPKAVQIPDIHLVKASSPVSQRKRLDVHGDLETEGKIASPNHMRLPASHVDLKCHFYPLK
TSHSTQHAPTIAETGKNIYHSEPANLNGCGKNRNGKILQTSVCSVM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatccctgtcatgcttgtgtgtgcacacggtgggagagtcacagcagacccaca
gcagcaactctcttgacatcccagccgaggcccgctgcagacatggggcgtcaggaggcc
gacaacttgtggaaaaaagacacgcaagacattcaggagatttttgacttcatggaggag
ttgggatcgggggccttctccgaggtcttcatggtgagggagaagaagacgggaaggacg
ttcgcaatgaagtgtgtcaagaagaaacaaaccagggacctaactttggagaacgagatc
gccgtgctcaggagaatccaacatgagaatgtggtggggatggaagatttctatgaaagt
cagacacatttctacctggtcatgcagctcgtgtccggcggcgagctctttgaccgcatc
ctggaccgaggtgtgtactccgaaatggacgccagtcgcgtgatccaacaggtgctgcat
gcagtcagctacttgcatcaaaatggcatcgtgcatcgagacctcaagccggagaacatt
ctgtactacagcccagaggagaactccaagatcatgatcagtgactttggcttgtccaag
atggtggacaagggtgttatgtccactgcttgtggcactccaggatatgttgctcctgag
gtcttggcacagaagccttacagcaaggcagtggactgctggtctattggagtgatcacg
tacatattactgtgcggctatcctcctttctacgaagagagcgagacgcgcctcttctcc
aagatcatgaaggcgcagtatgagtttgactcgcccttctgggacgacatttccgaatcg
gccaaagacttcatccgaaacatgatgcagaagaatcccctcatgcgctacaccactgag
caagcgctcaggcacccctggataatcggaaagacggcccgcagccaggacatctactat
tcagtcagcgtgcagatccaaaagaactttgccaagtccaagtggaagcaagccttcaac
gccgccgtggccatcaaccacatgaagaaactacagctggcgcacgccgcggccgagcag
gtccccaaggccgttcagatcccggacatccacctggtcaaggcatcttccccggtctcg
cagcgcaagcgtctcgatgtgcacggcgacctggagaccgaaggaaaaatagcgtccccg
aaccacatgaggctgcccgccagccacgtggacctcaagtgccacttctacccactgaag
accagccacagcacacagcacgcgcccaccatcgctgagacggggaagaacatctaccac
tcagagcccgccaacctcaacggctgtggcaaaaacagaaacggaaagatccttcagacc
agcgtttgctctgtcatgtga

DBGET integrated database retrieval system