KEGG   Hippocampus comes (tiger tail seahorse): 109514829Help
Entry
109514829         CDS       T04969                                 

Gene name
mtmr14
Definition
(RefSeq) myotubularin-related protein 14
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00562  Inositol phosphate metabolism
hcq01100  Metabolic pathways
hcq04070  Phosphatidylinositol signaling system
hcq04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109514829 (mtmr14)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109514829 (mtmr14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109514829 (mtmr14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109514829 (mtmr14)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     109514829 (mtmr14)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     109514829 (mtmr14)
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    109514829 (mtmr14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase3 Myotub-related Y_phosphatase BOFC_N Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 109514829
NCBI-ProteinID: XP_019723784
UniProt: A0A3Q2Z1Z6
Position
Unknown
AA seq 655 aa AA seqDB search
MMAASPSVAGGFKATGLSARKGEEIMDLIDLFSKTQYRAKEVTPRMESIETCCLELFAKD
YKYSVIHNANGEVCGHYPRRIVFLEYECTDVDRDRFESTVQISKLQDLVNRSKLARCRGR
FVCPVIFYNGKHICRSSTLAGWGELYGRTGYNYIFSGGSDDTWADSEEIPEDDCGVRNGD
SQLFDKVRGHDIKLLRYLSVRYICDLMVENKKVKFGLNVTSSEKADKAQRYADFTLLSVP
YPGCEFFKDYKDRDYTAEGLVFNWNQDYVDAPLTIPECFTKNLNIDWAQYQSWDLVEQTQ
NYLKLLLHIINSDDESGLLVHCISGWDRTPLFVSLLRLSLWADGAVHSSLEAAEILYLTI
AYDWFLFGHMLPDRLSKGEEIFFFCFNFLKHIVSEKFSAVKKHRRKNSHCKDGDFTVEDL
CQLKSRDRGSVTSLSSDFSLITEEVGVTSSFTSDTVDLFCGQPSLSTWKKGTASSPQMVV
WSKQNPLDEQLPHPHSEARSSSSSSSNHSEHGITRTGSSPLAVPSRRFAADYNRSGSSLS
TEYGSWQIVSGCGSIHDHPPYQPPLASASTTSSALAAPYDSLLPFSFQEEGPNGRLCPFP
SERQARLEAVREIFLAAYSSTVGLKSVASSPSGAITGLLEQFARGVGLRSTNTLV
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgcctccccctccgtggccggtggcttcaaggctactgggctgtcggccaga
aagggcgaagaaataatggatttgatcgacttattttccaagacccagtacagagcaaag
gaagtcactcctcggatggagtcaatagaaacctgttgtttggagttgtttgccaaagat
tacaagtacagtgtaatccataatgccaatggtgaagtgtgtggccattacccacggcgg
atagtgttcctggagtatgaatgcacagatgttgatcgagacaggtttgagagcacagtg
cagatcagtaagcttcaagatttggtgaaccggagtaaactggcccgatgcagagggcgc
ttcgtctgtccagtcattttctacaatggcaagcacatttgtcgttcgtccactctggca
ggctggggggaactctatggacgcacaggctataattacatcttttctgggggcagtgat
gatacatgggcagactctgaggagattccagaggatgactgtggagtcaggaatggggac
tcacagctttttgataaggtccgaggccacgacattaagctcctccggtacttgtccgtt
cgctacatctgcgaccttatggtggagaacaagaaggttaagtttggcctgaatgtgaca
tcttctgagaaggctgacaaagcccaacgctatgcagacttcactttgctctctgtgcct
taccctgggtgtgaattttttaaagactacaaagaccgagactacacagctgagggactt
gtgttcaactggaatcaggactatgtggatgctcccttgacgatccctgagtgcttcacc
aagaacttaaacattgactgggctcagtaccagtcgtgggacctggtggaacagacgcag
aactacctgaagctacttctacacatcatcaacagtgatgatgaaagtggccttcttgtg
cactgcatatcaggctgggaccgaacacctctgtttgtttcgctcctcaggctgtctctt
tgggcagatggtgcggtacacagcagtctggaagcggctgagatcttatatctgaccatt
gcttatgactggttcctctttggtcacatgctgccagaccgactctccaagggggaggag
attttctttttttgcttcaattttttgaagcatattgtctcagagaagttctctgctgtt
aaaaaacacagaaggaagaactctcactgcaaagatggtgattttacagtcgaggacctt
tgccagttaaagtccagggaccgtggaagtgtgacaagtctgagcagtgacttttccctc
atcaccgaggaagtgggtgtgacttccagcttcacgagtgacactgtggacctcttctgc
ggccagccttcactttcaacttggaaaaaaggcaccgcctcctctcctcaaatggttgta
tggagcaaacaaaaccctctggatgaacagctcccacacccccacagtgaggctcggtct
tccagttcatcctcctccaatcactcagaacacggcatcacgcgcacgggaagcagccct
ttggctgtacccagccgaaggtttgcagcagactacaatcgatccgggtcttcgctgtct
acagagtatggtagttggcagattgtctctggttgtggtagcatccatgatcatcctccc
tatcagccaccgctggcttcggcctccaccacctcgtctgctctggctgctccctacgac
tccctcctgcccttcagctttcaggaggaaggacccaacggacgactgtgtccctttccc
tcggaacgtcaagcccgtctagaagctgtgcgggaaatcttcctggcagcctacagttct
acagtgggtctgaagtctgtcgcgtccagtccttctggtgccatcacaggcctgcttgag
cagttcgcccgtggtgtcggcctccgaagtaccaacactcttgtctaa

DBGET integrated database retrieval system