KEGG   Hippocampus comes (tiger tail seahorse): 109514923Help
Entry
109514923         CDS       T04969                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04260  Cardiac muscle contraction
hcq04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109514923
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109514923
   04261 Adrenergic signaling in cardiomyocytes
    109514923
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hcq04040]
    109514923
Ion channels [BR:hcq04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109514923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 109514923
NCBI-ProteinID: XP_019723943
Position
Unknown
AA seq 315 aa AA seqDB search
MKMLMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSSGDNDTSRKNEEVM
THSGLWRTCCLEGTFRGVCKKIDHFPEDADYEADAAEYLLRAVRASSIFPIMSVGLLFLG
GLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWS
FYFGALSFIMAEMVGVLAVHMFIEKHRKQRAKSRTELIKKSAFSRIPSYRYRFRRRSSVR
SSEVPSRDASPLGKVGYTGPGASEMPMYTLNPREAGNAASKSGLGGLLNSEREFLQSSTL
TKDYAKDPNRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctgatgtgtgaccgcggcgtccagatgctcgtgacgacggtgggcgcgttc
gccgccttcagcctcatgaccatcgcagtggggacagactactggttgtactcgcgaggg
gtctgccgcgtgaaaagcagcggcgacaacgacacgagccgcaagaacgaggaggtaatg
acgcactccggcctctggcggacctgctgtctggaaggaaccttccgaggtgtgtgcaag
aagatcgatcacttccccgaggatgctgactacgaggccgacgccgccgaatacctcctg
cgtgcagtgcgtgcctccagtatcttccccatcatgagtgtggggctgctgttcttggga
ggactctgtgtagccgccagtgagttttaccgcagccgacacaacgtcatcctcagcgca
ggaatcttctttgtctccgcaggcctcagtaacatcattggaattattgtctatatttcg
gccaactcaggcgatccgggccaaagtgacagcaagaagtcctactcctacggctggtcg
ttctactttggcgctctctccttcatcatggcagaaatggtgggagtgctggcggtgcac
atgttcatcgagaagcaccgcaagcagcgggccaagtcccgcaccgagctcatcaagaag
tccgcctttagccgcatcccctcctatcgttaccgcttccggcgccgctccagcgtccgc
tcgtcggaggttccgagccgcgacgcctcgccgctgggtaaagtgggttacacggggccc
ggcgcctccgagatgcccatgtacacgctgaacccacgcgaggcgggcaacgccgccagc
aaatccggcttaggtgggctgctcaactcggagagggagttcctccagagtagcacgctc
actaaagactacgccaaggaccccaaccgcaggaccacgcctgtctga

DBGET integrated database retrieval system