KEGG   Hippocampus comes (tiger tail seahorse): 109515847Help
Entry
109515847         CDS       T04969                                 

Gene name
mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00450  Selenocompound metabolism
hcq00970  Aminoacyl-tRNA biosynthesis
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109515847 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109515847 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hcq01007]
    109515847 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hcq03016]
    109515847 (mars2)
Enzymes [BR:hcq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109515847 (mars2)
Amino acid related enzymes [BR:hcq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109515847 (mars2)
Transfer RNA biogenesis [BR:hcq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109515847 (mars2)
 Prokaryotic type
   Other AARSs
    109515847 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 109515847
NCBI-ProteinID: XP_019725462
UniProt: A0A3Q2YT64
Position
Unknown
AA seq 597 aa AA seqDB search
MRTIFCFITRSCKADGSWKQSAFLSPHSTQRRVRCTRSDVCNEERSYYITTPIFYVNASP
HLGHLYSAILADCMHRYKLLRGFKSRFATGTDEHGLKIQQAANAAGEAPLTFCTGVSQRF
RQLFGSCNVSFTDYIRTTEERHRRSVEHFWCTLYDKGFIYKGNYEGWYSTPDESFLTPTQ
VADAVDASGQAIKVSLESGHKVEWLKEENYMFRLSAFRTPLLDWLQKNPRAIQPERFLQD
VLQWLQDDLPDLSVSRQRSRLQWGIPVPGDPEHTIYVWLDALVNYLTVVGYPDNHNHWWS
VARHIVGKDILKFHTIYWPSFLLGAGLPPPQSIHVHSHWTVNGTKMSKSLGNVVDPFERS
QAFTTDGLRYFLLRQGVPDSDCDYADHKVTKVLNAELADSLGGLLNRCTAPALNLTQTYP
PFCPLFFPNERDGRAVPEDYHLLDAVRNLPTLVERHYESLHVYKALEAITSCVRQTNGFV
QRHTPWKLNRMDSGDQRWLDTIIHVTLECLRIYGTLLQPVVPRVADKLLSRLGVRADERN
WSDLDFLPSYSGKDCRFQGRTLGPDTGVLFNRLESPTGDEQKPKKIKKQTIISRQFT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccattttctgcttcatcaccaggagctgtaaagctgatggcagctggaaacaa
agtgcctttttatcaccacattcaacgcaacgcagagtcagatgcacacgcagcgatgtg
tgcaatgaggaaagaagctactacataaccactcccatcttctatgtcaatgcctctcct
catctgggccacctgtattcagcaattttagccgactgcatgcacagatacaagcttctc
cggggattcaagtcgagatttgcaacaggcacggatgagcacggtttaaaaatccaacag
gcggccaatgcagcaggagaagcccccctgaccttctgcactggcgtgtcccagagattc
cggcagctctttggcagctgcaatgtgtccttcacagactacatcaggaccactgaggag
aggcaccggcggtccgtagagcacttctggtgcacgttgtatgacaaagggttcatctac
aagggcaactatgagggctggtactccacgccagacgagagcttcctcacgccgacgcag
gtggcagacgccgttgatgcgagcggccaggctatcaaggtttcactggagagtggtcac
aaggtggaatggctgaaagaggagaactacatgttccgtttgtcagcatttcggactcca
ctgcttgactggctccagaaaaaccccagagctatccagcccgagcggttcctccaagat
gttctccagtggctgcaggatgaccttccggacctctctgtgtcccgccaaagaagccgc
ctccagtgggggattcccgtcccgggggatcctgagcacaccatctacgtgtggttggat
gctctggtaaactacctcacggtagttggttaccccgacaaccacaatcattggtggagc
gtggcccgccacatcgtcggcaaagacatcctgaaattccacaccatctactggccgtct
ttcctccttggggcgggactgccgccgccgcagtccatacacgtgcactcacactggaca
gtcaatggaaccaagatgtcgaaaagtttgggcaacgtggtggacccctttgagcgctcg
caggcgttcaccaccgacggtttgcggtacttcctgctgcgtcaaggcgtgcctgattcc
gactgtgactacgcagatcacaaagtcaccaaggtgctcaacgcggagctggctgactcc
ttgggtggcctcctcaaccgctgcaccgctcccgcgctcaacctaacacagacctaccca
ccattctgccctttgtttttcccaaatgagcgggatggtagggcggtgccagaagactac
cacctgctggatgctgtgcgaaacctcccaacgttggtggagcgtcattatgaaagcctg
cacgtatacaaagccttggaggccatcacttcctgtgttagacaaaccaacggcttcgtt
caacggcatacaccttggaagttgaacaggatggacagcggagaccaacgttggctggac
acaatcatccatgtcactctggaatgtctgaggatttacgggaccctcctgcagcctgtc
gtgccgcgagtagccgacaagttgctgtccagactcggcgtgcgagctgacgagaggaac
tggagcgacctggacttcctgccaagttacagtggcaaagactgccgcttccaagggaga
acactaggacctgatacaggagtgctttttaatcgtctggaaagtcccactggagatgag
caaaaaccaaagaaaattaaaaagcagacgattatctcaaggcagtttacataa

DBGET integrated database retrieval system