KEGG   Hippocampus comes (tiger tail seahorse): 109516227Help
Entry
109516227         CDS       T04969                                 

Definition
(RefSeq) adenosine kinase-like isoform X1
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109516227
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     109516227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin SEO_C Raf1_N
Motif
Other DBs
NCBI-GeneID: 109516227
NCBI-ProteinID: XP_019726141
UniProt: A0A3Q3DIG0
Position
Unknown
AA seq 391 aa AA seqDB search
MASSEEPKAKKPKISAHEDSDCAPKTSPIKLSSLNRSLAPAQTDREMSVLSPNSLFGMGN
PLLDICAVVDKDFLDKYTLKPNDQILAEDKHKALFDEIVNKFKAEYHAGGATQNSIKIAQ
WMIQEPHNVGTFFGCIGKDKFGEILKQKAEEAHIDAHYYEQDKEPTGSCAACVTGANRSL
VANLAAANCYKKEKHLDLEENWKLVEKAKVYYIAGFFVTVSLESMLKVAKHASENNKLFC
LNLSAPFICQFFKDHLMQLLPYVDVLFGNETEAAAFAKEQAFETKDIKEIAKKVQALPKI
NTKRQRIVVLTQGTDETVMALSDKIETFPVMAIDPKDLVDTNGAGDAFVGGFLSGLVREK
TLDQCVRAAHYAANVIIRRLGCTFPEKPDFV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccgaagaacccaaagctaagaaacctaaaatttctgcacatgaggattcg
gactgtgcacccaaaacatctcctatcaaactaagctcgctcaacaggtctctagcacct
gcacagactgacagagagatgtctgtattgagccctaattcactgttcgggatgggaaat
cccttgcttgacatttgtgccgtggtggacaaagacttcctggacaaatacacactcaaa
ccaaatgaccagatcctggctgaggacaagcacaaagcactatttgacgagatagtgaac
aagttcaaagcggaataccacgctgggggagccacacagaactccatcaagattgctcag
tggatgatccaggagcctcacaacgtgggcactttcttcggatgcatcggcaaagacaag
tttggggagatcctgaagcagaaggcagaggaggcccacatcgatgcccactattacgag
caagacaaggagcccacgggctcgtgtgcagcgtgcgtcaccggagcgaaccggtcactg
gtggctaacctggctgccgctaattgttataagaaggagaaacatctggaccttgaagaa
aattggaagttggtggaaaaggctaaagtttactatatagctggtttctttgtcacagtg
tctttggagtccatgctgaaagtcgccaagcacgcgtcggaaaataacaaactgttctgc
ctcaacctgtcggcacccttcatctgtcagtttttcaaggaccatctcatgcagctcttg
ccttacgtggacgtgctcttcggcaatgagacggaggcagccgcattcgcgaaagagcaa
gcttttgagaccaaagacattaaggagattgccaagaaagtgcaggccctgcccaaaatc
aacaccaagcgacaaaggattgttgtcttgactcaggggacggatgaaactgtgatggct
ctcagtgataaaattgagacctttccagtgatggcaattgatcccaaagacctagtggac
acaaacggtgctggtgacgcctttgtaggaggtttcctgtctgggctggtccgagaaaaa
acactggaccaatgcgtgagagcagctcactatgctgccaacgtcatcattagaagattg
ggttgcacgttccctgaaaagccagactttgtttga

DBGET integrated database retrieval system