KEGG   Hippocampus comes (tiger tail seahorse): 109516520
Entry
109516520         CDS       T04969                                 

Definition
(RefSeq) adenylate cyclase type 4-like isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq01100  Metabolic pathways
hcq04020  Calcium signaling pathway
hcq04114  Oocyte meiosis
hcq04261  Adrenergic signaling in cardiomyocytes
hcq04270  Vascular smooth muscle contraction
hcq04371  Apelin signaling pathway
hcq04540  Gap junction
hcq04912  GnRH signaling pathway
hcq04914  Progesterone-mediated oocyte maturation
hcq04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109516520
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109516520
   04020 Calcium signaling pathway
    109516520
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109516520
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109516520
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109516520
   04914 Progesterone-mediated oocyte maturation
    109516520
   04916 Melanogenesis
    109516520
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109516520
   04270 Vascular smooth muscle contraction
    109516520
Enzymes [BR:hcq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109516520
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 109516520
NCBI-ProteinID: XP_019726704
Position
Unknown
AA seq 1222 aa
MEPDQEAAGALRVDGVTQTGIVALELDHIADTADDEGLLASQSGLSQSQASAHLPEPLLV
DFLSTSGSDAPEVDPSSQNLDLAFDSDYGSTHSSPGSASTAFSGDLSELTGSSFENTNSL
SPANLFEHTLGGNQSKKRAKKKQTTKSSKKKENASTPNEVVSTSSSADHEEGHGSTHSQR
SVAESVNCCYRSMHRGCLQCGEETPAMLTGLVLSLAFCIAIIVLIPTMGRNLDVHVGALS
VLCVVLCLSAGLLVCLPWLATVRRCAGALALFVWGTLYVTAIVFIFTGGPVTTWEQVAFF
LFLSLSVYTVLPLSLAWALMVGIWTSVSHIIIISVYVPVTSPETPDLAVQLVANGILFLC
VNCIGVFHLWTTENDLRKSNRKREKFSTIRSQKEIRKYQQERLLLSVLPRYIAIELKTEV
IKRLTKPTSEKENRHNFHSLYIRQHKDVSILYADIVGFTKLASSCTPEELVAMLNKLFGR
FDDIAKKNGCLRIKILGDCYYCVSGLPDPIPTHASNCVQMGLDMCTAISKLREATGVEIS
MRVGVHTGNVLSGVIGLQKWQYDVWSHDVTLANHMESGGVPGRVHITEETLQHLNGAYQV
EDGDGGSRDPLLQGRKTFLVLDPNNSGSLFQRSTTANLLTTVENTQRASMRMSQYLQSWR
NIRPFADLSNHHAKLPKKINEVAANQQQSFAERPPFQNNPSCLFVDNRVRGSLDTMDIAG
WRAKRLNCFTLLFNDIRLEKQFRLSEVKGLHQSMSCLALVFVTLFAVQMLVSEKNFQLAV
SYSATFPVLVLLLSIAFCGYLQKCHSKTRPRIHWMSGLCRRMSTRAALRLFIVCLSLLIT
LLMAILNFVFIPGNNCTDISDRRALEDLKLYTVPYYLYCCLVAMLGVIVFVRICLSIKAL
LLTLAVVVYLALFLHVYANRSSCLIDLLYNTTTKPGVLKDPQIMSGVWLVIFYIVCIILA
RQDELGCRVDFLLEHCFKLEQEEMETVENVNKLLLQNVLPLHVASFFMGKTVRNQDLYSQ
SYECVCIMFASVPQFKEFYSESSATRDGLECLRFLNEIIADFDELLSKPKFSSVEKIKTI
GSTYMAAAGLTQSWDERKKCDMSYSHVRSMVEFAIALMSNLELINTHSFNSFKLRIGINQ
GPVIAGVIGAHKPQYDIWGNSVNVASRMDSTGVLDRIQVTEETAQAVQSVGYGITLRGVI
NVKGKGELTTYFVNTEHSSPHV
NT seq 3669 nt   +upstreamnt  +downstreamnt
atggagcctgaccaagaagcggcaggagcattgcgggttgatggcgtgacccaaactgga
atcgtcgcactcgagcttgaccacatcgcagacactgctgatgacgaaggactactggct
agccaatcaggactctcacaaagtcaagcgtctgcccacctacccgagcctctgctggtg
gattttttgtcgacgtctgggagcgacgcaccagaggtggacccgtcctctcaaaacttg
gacctcgcctttgactcggactatggcagcactcactccagccccggttccgccagcacc
gctttcagtggcgacctaagtgaactcactggaagttcctttgaaaataccaactctctt
tctcctgccaacctctttgaacacactttgggaggaaatcagtccaaaaaaagggcaaaa
aaaaaacaaactaccaaatctagcaagaaaaaggaaaacgctagcacaccaaatgaggtt
gtgagtactagcagcagtgcggaccatgaagaaggacatggaagcacacattcccagcgc
agcgtcgcagaaagcgtcaactgttgctacaggtccatgcacaggggctgtctgcagtgt
ggggaggagacgccggccatgttgactggactggtgctgtccttagctttctgtatcgcc
atcatcgtccttattcctaccatgggaaggaaccttgacgttcacgtgggagctctgtcg
gtgttgtgcgtggttctgtgtctgagcgccggcctgctggtgtgcctaccgtggctggcc
accgtgagacgctgcgccggcgccctggccctcttcgtctgggggacgctgtacgtcacc
gccattgtattcatcttcaccggaggacccgtcacaacgtgggaacaggtggctttcttc
ctcttcctgtcattgagcgtgtacacggtgctccctctctcactggcctgggctctcatg
gttgggatttggaccagcgtttcgcacatcatcatcatcagtgtttatgtcccggtcaca
agtccggagacgccagacttggctgtgcagctggtggcaaatggcatcctgttcttgtgt
gtgaactgcatcggagtcttccacctgtggaccaccgaaaacgatctcaggaaatccaat
cgcaagagagagaagttcagcaccatccgctcccagaaggaaatcagaaaataccagcag
gagcgtctgctgttgtcggtgttgccgcgttacatcgccatagagctgaaaacggaggtg
attaagaggcttactaagcccacgagtgagaaagaaaatcgacacaacttccacagtctg
tacatacggcagcacaaagacgtcagcattctgtacgcggatattgtgggcttcacaaaa
ctggctagtagctgcacaccagaggagcttgttgctatgctcaataagctctttggcagg
tttgacgacatcgccaagaagaacggatgccttcgcatcaaaattttgggcgactgctac
tactgcgtgtcaggactgcctgacccgatccccacgcacgccagcaactgtgttcagatg
ggcttggacatgtgcaccgctatcagtaaactgcgagaggccacaggagtggagatcagc
atgcgcgtcggcgttcacacgggcaacgtgctctctggtgtgatcggcttgcaaaaatgg
cagtacgacgtgtggtcacatgacgtgacgctcgccaatcacatggaatccggaggcgtt
cctgggcgagttcacatcacggaagagactctgcaacacttgaacggagcgtaccaagtg
gaggacggcgacggcgggagtcgggatcctcttcttcaaggaaggaaaaccttcttggtt
ctggaccccaacaactccggcagccttttccaaagatcgacaacggccaaccttctcacc
accgttgagaacacgcagcgggcgtccatgcgcatgtctcagtaccttcagtcgtggcgg
aacatccgacccttcgccgacctcagcaaccatcacgccaagctccccaagaagatcaac
gaggtcgcagcgaaccaacagcagtcatttgctgaaagaccaccttttcagaacaaccca
tcctgtttgtttgtagataaccgtgtgaggggttcgctggacacgatggacattgcaggg
tggagggccaaaagacttaactgtttcacgctgctgtttaatgacatacgcttggagaag
cagtttcgcctgtcagaggtgaagggcttacaccagtccatgagctgcctcgctttggtc
tttgtcaccctttttgctgtccaaatgctcgtttctgagaagaactttcaattggccgtt
tcctacagcgccacctttcctgtgctggtacttcttttgtccatcgcgttctgtggctac
ttgcagaaatgtcattccaagacacggccccgcattcattggatgtcaggactgtgtcgt
aggatgtccaccagggcggcgctgcggctgtttatcgtgtgcctgagtttactcatcaca
ctgctgatggccatcctcaactttgtcttcatcccaggaaacaactgcaccgatatcagc
gacaggagggcgctggaggatctcaaactctacactgtgccttactacctgtactgctgc
ctggtggccatgctgggagtcatcgtcttcgtcaggatatgtttgtcgataaaggcgctg
ctcctcacgctggccgtggtggtttacttggccctcttcctccacgtatacgccaaccgc
tcgtcctgcctcatcgacctgctgtacaacaccaccaccaagcccggtgtgctgaaggac
cctcagatcatgtctggcgtttggctggtcatcttttatattgtctgcatcatcctggcc
agacaggatgagctgggctgccgcgtagacttcctgttggaacactgtttcaagttggaa
caagaggagatggagactgtggagaatgtcaataagcttctgctccagaacgttctgccc
cttcacgtggcttccttcttcatgggcaaaactgtccgcaatcaggacctatacagccag
tcgtacgagtgcgtgtgcatcatgttcgcctccgtgcctcagtttaaggagttttacagc
gagagcagcgccactagagatggtctggagtgtttacgtttcctcaacgagatcattgcc
gactttgacgagcttttatccaagccaaagttctcttcagtggagaagatcaagaccatc
ggcagtacgtacatggcagccgcggggctgacgcagtcatgggatgagagaaagaaatgt
gacatgtcctacagtcacgtgcgctccatggtggagtttgccatcgctttaatgagcaat
ctggagctcatcaacacgcactccttcaacagctttaaactgcggataggaataaaccag
ggccccgtcattgctggagtcatcggtgctcataaaccgcagtacgacatctgggggaac
tcggtcaacgtggccagcaggatggacagcacgggagtgttggacaggatccaggtgaca
gaggagacggcccaggcggtccagagcgtgggctacggtatcacactccgaggagtcatc
aacgtcaaggggaaaggggagctgaccacgtactttgtcaatacagagcactcatctccg
cacgtctga

DBGET integrated database retrieval system