KEGG   Hippocampus comes (tiger tail seahorse): 109516852Help
Entry
109516852         CDS       T04969                                 

Gene name
plk3
Definition
(RefSeq) serine/threonine-protein kinase PLK3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109516852 (plk3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109516852 (plk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109516852 (plk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109516852 (plk3)
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109516852 (plk3)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     109516852 (plk3)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   109516852 (plk3)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    109516852 (plk3)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109516852 (plk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POLO_box Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 109516852
NCBI-ProteinID: XP_019727202
Position
Unknown
AA seq 565 aa AA seqDB search
MDIGCFTAAQRLSCHAMNADLTNKPAAEGAQQAGAPGAKAGRSKSESAKPELAQVVTDVR
TGRSYSKGKLLGKGGFARCYEMTDLSNNKMFAVKVIPQSRVSKPHQREKVPHFPLYQIKT
ICGTPNYLAPEVLNRQGHGTESDVWSLGCVMYTLMCGNPPFETLDLKETYKCIKEVRYNL
PSGLSPAAQKLISSILQKTPSDRLSLDQILNHEFFTKGFTPDKLPPNSCVTVPELHPPSP
AKKFFTKVAKSLFGKKKAKAEKAPCEEKEDKDISKLVSGIVKCSINRQISYKTVGPNEVP
TPTGQLVNSVPLEQTPAEEESRKSISRSFKGTMANSSEPCEDVVTPSFVAESAMKVLSGC
LAIMPAATRNPPCLSRPQSFLWVTKWVDYSNKYGFGYQLSDQSIGVLFNEGTHLSLCDQR
KTVHYCLTNNKHFSFPASSLPEQLRNQKQIVELMANYMEQNLMEGGDIHCHELVPGPPPL
LLQWVKTDHALVMLFNNGTLQVNFYTDHTKIILSKSLDSYLLTYISRERVSYTYLFSMLS
EMGCTAELRHRLRYVLHLLQHHADA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggatatcggttgtttcacggcggcgcagcgtctgtcgtgccacgccatgaatgcggat
ttaaccaacaagcctgccgctgagggagcccagcaagccggcgctccgggagccaaagcc
ggccgctcgaaatcggagtctgccaaaccggagttggctcaggtggtgaccgacgtcagg
acgggacggtcgtacagcaaagggaagcttttgggaaagggtggcttcgcgcgatgctac
gagatgacggacctgtcgaacaacaaaatgtttgccgtcaaggtgattccacagagcaga
gtgtccaaaccgcaccagagggagaaggtaccacattttcccctctaccaaataaaaacc
atctgtggaacccccaactacttggcccccgaggtactcaacaggcagggccatggcaca
gagtcggacgtttggtccctcggatgcgtcatgtacacgctgatgtgcggcaacccgccc
tttgagactcttgacctgaaagagacgtacaaatgcatcaaggaagttcggtacaacctg
ccctctgggctctcgcccgctgcgcagaaactcatctccagcatcctgcagaaaaccccc
agcgacagactcagcctggatcaaattctcaaccatgaattcttcaccaaaggtttcact
cccgacaagctcccccccaacagctgcgtaacggtgcccgagctccatccccccagcccg
gccaagaaattcttcaccaaggtggccaagagtctctttggcaagaaaaaagcgaaagcg
gagaaggcgccttgtgaggagaaagaggacaaagatatttccaagctggtgtccggcatc
gtcaagtgctccatcaaccgccagatcagctacaaaaccgtcggcccaaatgaggtgccc
acgcccaccggtcaactggtcaactcggtgcctttggagcagacccctgctgaggaggaa
tccaggaagtccatctcgcgctccttcaaaggcaccatggccaacagctcagaaccttgt
gaggatgttgttactccctcctttgtggctgaatctgccatgaaggttctcagtggctgc
ttggccatcatgcctgcagccacaagaaacccaccgtgcctgtccaggccccaatccttc
ctgtgggtcaccaaatgggtagactattccaacaaatacggttttggctaccagctgtca
gaccaaagcatcggggtgctcttcaacgagggcacacacctcagcctctgtgaccaacgc
aagacggtccactactgcttgaccaacaacaagcactttagcttccctgccagctcgcta
ccggagcagcttcggaaccagaaacaaattgtcgagctcatggccaattacatggaacaa
aatctcatggagggtggtgatattcactgtcatgaactagttcccggtcctcctcctctg
ctgctgcagtgggtgaagacggaccacgcgctcgtcatgctcttcaacaatggaacgctg
caggtaaacttctacaccgaccacacgaagatcatcctgtccaagtctttggattcgtac
ctgctgacctacatcagccgcgagcgcgtctcctacacgtacctcttcagcatgctgagc
gaaatgggctgcacggcggagctgcggcaccgcctcagatacgtcctccatctcctgcag
caccacgccgacgcctga

DBGET integrated database retrieval system