KEGG   Hippocampus comes (tiger tail seahorse): 109517345Help
Entry
109517345         CDS       T04969                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hcq01002]
    109517345 (abhd12b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109517345 (abhd12b)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109517345 (abhd12b)
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109517345 (abhd12b)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109517345 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 LIP Thioesterase Peptidase_S15 Acyl_transf_2 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 109517345
NCBI-ProteinID: XP_019728031
Position
Unknown
AA seq 323 aa AA seqDB search
MKVISFLVLVYVTVPFTIYLCPWILDYAIFAHLLRLPYLVDLNHPEYVLNHTCNFYLDPE
EGVRVGVWHTLPASQWDEAAGRGPDWYRKALGDGSPVIIYLHGNVGTRAKNHRVQLAKIL
SSAGFHVLSLDYRGFGDSTGEPSERGMTTDAFHLYTWVKQHSGGSLVCLWGHSLGSGVAS
NTAVKVQEQGSIVDALILEAPFTNIGEVVVDFPLAKLYTFLPGFELFLWNTLEKNKLIFA
NEDNLKVLTCPLLILHAEDDDMVPYSMGQKLYQISLRTHRERSKEVPLKMISYPATRGFS
HNDIYLDPDLATSVGDFLQKLRG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaatatccttcctggtgcttgtctatgtgacagtgccattcaccatctacctg
tgcccttggatactggattatgccatttttgctcacttgctgaggcttccatatttggtg
gatctcaaccatccagaatacgtgcttaaccacacgtgcaacttctacctggacccggag
gagggcgtccgtgtgggtgtatggcacacgctccctgccagccaatgggatgaggcggca
gggagaggccccgactggtaccgcaaggctctgggagatggaagtcctgttatcatctat
ctccatggtaacgtgggcaccagggccaaaaatcacagggtgcaactggcaaagatttta
agctccgcagggttccacgtcctgtctttggactacagaggcttcggcgattcgacaggg
gagccgagcgaacgcgggatgaccacagacgccttccacctgtacacatgggtgaagcag
cacagtggggggtctctggtgtgtctgtgggggcactcactcggttccggggttgcgagc
aacaccgccgtaaaggtgcaagagcaaggttccatcgtggacgccttaattctcgaggct
ccgttcacaaatatcggcgaggttgttgtcgactttcctctggctaagctctacacgttc
cttccgggctttgaactcttcctgtggaacactttggagaagaacaagctaatttttgct
aacgaagacaatttaaaggtgctgacctgtccgttgctcattctgcacgcggaggacgac
gacatggttccgtatagcatgggtcaaaagctgtaccagatttcattgcgcacgcacagg
gagcgcagcaaagaagttccgttgaaaatgatctcctacccggcgactcgcggattctcc
cacaatgacatctatttggatcccgacctggccacgtcggtgggcgattttctgcagaag
ctacgagggtag

DBGET integrated database retrieval system