KEGG   Hippocampus comes (tiger tail seahorse): 109519910Help
Entry
109519910         CDS       T04969                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00020  Citrate cycle (TCA cycle)
hcq00640  Propanoate metabolism
hcq01100  Metabolic pathways
hcq01200  Carbon metabolism
Module
hcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109519910 (suclg1)
   00640 Propanoate metabolism
    109519910 (suclg1)
Enzymes [BR:hcq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     109519910 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     109519910 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 109519910
NCBI-ProteinID: XP_019732332
UniProt: A0A3Q2Z501
Position
Unknown
AA seq 324 aa AA seqDB search
MSHCRLFARLLLQQSGVRHCYTGTRQNLYITKNTKVICQGFTGKQGTFHSQQSLDYGSQL
VGGVSPGKGGKTHLDLPVFNSVKEAKEGTGADATVIYVPPPFAAAAIIEAIDAEIPLVVC
ITEGIPQQDMVKVKHRLLRQSTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLRDPKTEGIILIGEIGGNA
EENAAEYLKQHNSGANAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAG
VVVSMSPAQLGSTMFKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactgcaggttatttgccaggctgcttttgcagcaaagtggcgtcaggcactgt
tatacaggaacaagacagaacctctacatcaccaagaacactaaggtcatctgtcaaggt
ttcacaggaaagcaggggacatttcacagccaacagtctctcgactatggatcgcagtta
gttggaggcgtgtctcctggcaaggggggcaagactcatcttgacctgcctgtcttcaat
tcagtcaaggaggcgaaggaaggcacaggagctgatgccaccgtgatatatgtgccgcct
ccatttgctgcagctgccatcattgaggccattgatgctgagattcccctggtggtgtgc
atcactgagggcatcccccagcaggacatggtcaaagtgaaacacagactcctgcgccag
agcaccactcgtctcattggcccgaactgcccaggagtcattaatcctggggagtgcaag
atagggatcatgcctggccacattcacaaaaaaggaaggattggtattgtgtctaggtca
ggaactctgacatacgaggccgtgcaccaaactacacaagttggtcttggccagtccctc
tgcattggtattggcggggatccgttcaacggtacgaacttcatcgattgcttggaggtg
ttcctgcgggatcccaagacggagggcataatcctgattggggagatcgggggcaatgca
gaggagaatgcagcagagtatcttaaacaacacaactcgggtgcgaacgccaagcccgtg
gtgtccttcatcgctgggcttactgctcctcccgggcgaaggatgggccatgccggtgcg
atcattgctggtggaaaaggaggcgccaaagagaaaattgctgccctgcagtcagctgga
gttgtggtcagcatgtcccccgcccagctgggcagcacaatgttcaaggagtttgagaag
aggaagatgctgtga

DBGET integrated database retrieval system