KEGG   Hippocampus comes (tiger tail seahorse): 109521663
Entry
109521663         CDS       T04969                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109521663 (rdh5)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     109521663 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 Phage_rep_O NAD_binding_10
Other DBs
NCBI-GeneID: 109521663
NCBI-ProteinID: XP_019735212
Position
Unknown
AA seq 330 aa
MEFVYELLGDNAWLYISATFAVLWIAAWLYRDSLEIEDVSNKYVFVSGCDSGFGNLLCKK
LERKGFHVLAGCLTEKGAEELKKMTGPYLKTVLLDVTSQDSIQKAMEWTKKEVGDSGLWG
IVNNAGRSLPMGPTEWMKVEDFHSTLKVNMNGVIGMTVTFLPLVKKARGRVVNVASVLGR
VAANGGGYCISKFAVESFSDCLRRDINYFGVNVCIIEPGFFKTAVTNLEPIERELHRLWN
QLSPEVQASYGDKYLDKYIRIQRFIMNAICDSDLTKVTGCMEHALTAVYPRTRYSAGWDA
KLLWIPLSYMPSCVVDIGLKLVLPRPSKSV
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtttgtttacgagcttttaggggacaatgcttggctgtacataagtgccaccttt
gccgtgttgtggattgccgcgtggttgtacagagacagcctggagattgaagacgtgtcc
aacaaatacgtctttgtgagcggctgtgactcaggctttggaaaccttctgtgcaagaag
ctagaacgaaagggcttccatgtgttggctggctgcctgaccgaaaaaggagccgaggag
ctgaagaagatgacggggccctacttgaagacggtactactggacgtgacgagtcaggac
agcatccagaaagccatggagtggaccaagaaggaggttggcgacagtgggctctggggt
attgtgaacaacgccggccgctctctgcccatgggtcccaccgagtggatgaaagtggaa
gacttccacagcacgctcaaggtcaacatgaacggtgtgatcggcatgaccgtgactttc
cttcccttggtcaagaaagcccgagggcgcgtggtcaacgtggcatctgtactgggccgg
gtggcggcaaacggcggcggctactgcatctccaagtttgccgtggagtctttctccgac
tgtctcaggagagatatcaattactttggggtgaacgtgtgcatcattgagccgggcttc
ttcaagacagctgtgaccaacctcgagcccatcgagagggaactgcaccgcttgtggaat
cagctcagccctgaagtgcaagcaagctacggggacaaatacttggacaagtacattagg
atccagcgcttcatcatgaacgccatctgcgactcggacctgaccaaggtgacaggctgc
atggagcacgcgttgaccgctgtgtaccctcggacccgctacagcgccgggtgggacgcc
aagctcctgtggatcccgttgtcgtatatgccgtcctgcgtggtggatatcggactcaag
ctggttctgccccgtccgtccaagagtgtgtga

DBGET integrated database retrieval system