KEGG   Hippocampus comes (tiger tail seahorse): 109522167
Entry
109522167         CDS       T04969                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3-like
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03410  Base excision repair
hcq04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109522167
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109522167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109522167
   03036 Chromosome and associated proteins [BR:hcq03036]
    109522167
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109522167
Enzymes [BR:hcq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109522167
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109522167
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109522167
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109522167
SSDB
Motif
Pfam: PARP PARP_reg WGR MmcB-like
Other DBs
NCBI-GeneID: 109522167
NCBI-ProteinID: XP_019736038
UniProt: A0A3Q2XG63
Position
Unknown
AA seq 524 aa
MAPKRRSASATKAGGKKIKAEPELPKPKDAFTSTKEALLAAGPQTKGKKKVDEHCSLSSK
GEVYKDYDCMLNYTNVRNNYNDFYVIQVIKAAKKYYSWDRWGRVGYVGYSNLNTFSDVKS
AVKDFEKKFKDSTMNNWSDRMNFVSHSGKYTLIEVDAGVTVDIVDGTAVKVTKNVLPCTL
DKAKQALIELIFSNDMFTAAMECMNLDVKKMPLGKLSKLQIAKGFEVLEEIEAALTQKSR
RPRLEELSSKFFTTIPHNFGRTRPPTIDNNNIVEKKKEMLMVLADIELAQTLKSETEKAQ
KEMIETVPDPLDQDYSSLKCKLSLLDKRSKTFKIIDKYLKQTQGYQKPKIVNVWEVDRET
EGARFQKHDDLENRRLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENSVSACY
VHMSKNTGVMFLSEVALGREHTITTDNSSLKKAPAGYDSVVARGRVEPDPSKDIFITLDG
KEVAVPQGKPITQSQYSESCFSNSEYLIYKESQCRLRYLLELKM
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcaccaaagagacggtctgcttctgctaccaaagcgggcggcaagaagatcaaggca
gaacccgagctaccgaagcccaaagatgcattcacctcgaccaaagaggctcttctggct
gcagggccacaaaccaaaggaaagaagaaggtggacgaacactgctcactgtcaagcaaa
ggagaggtgtacaaagactatgactgcatgctcaattatacgaatgttcgaaacaactat
aatgacttctatgttattcaagtcattaaagctgccaaaaagtactattcatgggacaga
tggggcagagtgggttacgtgggttactccaatctgaatacgttttcagacgttaagagt
gccgtgaaggactttgaaaaaaagttcaaggacagcaccatgaacaattggagtgatcgc
atgaattttgtgtctcactctgggaagtacactttgattgaggtggatgcaggggtcacg
gtggacattgttgatggaacggctgtcaaggtcactaaaaacgtcctaccttgcaccctg
gacaaagctaaacaggcgctcatcgagctcattttcagcaatgatatgttcacggcggca
atggaatgtatgaacttagacgtcaagaagatgcctttgggtaagctcagcaagttgcaa
attgcaaagggcttcgaggtgctggaagaaattgaagcagccttgactcaaaagagcagg
aggccacgtcttgaagaactttcctccaagttttttacaacaatcccgcataacttcggt
cgcaccagaccaccaaccattgacaacaacaacattgtggaaaaaaagaaagagatgctg
atggtgcttgctgatattgagctcgctcagactctgaaatcagagacagagaaggcacag
aaagagatgatcgagactgtccccgacccgcttgaccaggactacagttctctcaagtgc
aaactctctctgttggataaaagatcaaaaacgttcaagataatcgacaaatacctaaag
caaacacagggctatcagaagcccaaaattgtcaacgtatgggaagtcgacagagaaact
gagggggctcgatttcaaaagcatgacgacctggagaaccgccgtctgctgtggcatggc
actaacatcgccgtcgtggctgctatactgaagagcggcctgaggataatgccccattcg
gggggccgtgttggacgcggtatctattttgcatccgaaaactctgtgtctgcatgttac
gtgcacatgtcgaaaaataccggcgtgatgtttttgagtgaagtggccctcggcagagaa
cacaccatcaccacagacaactcttctttgaaaaaggcgcctgctggatacgattctgta
gttgcacgaggtcgagtggaaccagatccgtccaaagacatcttcatcaccctggacggc
aaggaggtggccgtcccacagggtaagcctatcacgcagtctcagtactctgagagctgc
ttcagcaacagcgaatatctcatctacaaagagagtcagtgtcgcctgcgctacctgctt
gagctgaaaatgtaa

DBGET integrated database retrieval system