KEGG   Hippocampus comes (tiger tail seahorse): 109522167Help
Entry
109522167         CDS       T04969                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03410  Base excision repair
hcq04210  Apoptosis
hcq04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109522167
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109522167
   04217 Necroptosis
    109522167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109522167
   03036 Chromosome and associated proteins [BR:hcq03036]
    109522167
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109522167
Enzymes [BR:hcq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109522167
DNA replication proteins [BR:hcq03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109522167
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109522167
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109522167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR MmcB-like
Motif
Other DBs
NCBI-GeneID: 109522167
NCBI-ProteinID: XP_019736038
UniProt: A0A3Q2XG63
Position
Unknown
AA seq 524 aa AA seqDB search
MAPKRRSASATKAGGKKIKAEPELPKPKDAFTSTKEALLAAGPQTKGKKKVDEHCSLSSK
GEVYKDYDCMLNYTNVRNNYNDFYVIQVIKAAKKYYSWDRWGRVGYVGYSNLNTFSDVKS
AVKDFEKKFKDSTMNNWSDRMNFVSHSGKYTLIEVDAGVTVDIVDGTAVKVTKNVLPCTL
DKAKQALIELIFSNDMFTAAMECMNLDVKKMPLGKLSKLQIAKGFEVLEEIEAALTQKSR
RPRLEELSSKFFTTIPHNFGRTRPPTIDNNNIVEKKKEMLMVLADIELAQTLKSETEKAQ
KEMIETVPDPLDQDYSSLKCKLSLLDKRSKTFKIIDKYLKQTQGYQKPKIVNVWEVDRET
EGARFQKHDDLENRRLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENSVSACY
VHMSKNTGVMFLSEVALGREHTITTDNSSLKKAPAGYDSVVARGRVEPDPSKDIFITLDG
KEVAVPQGKPITQSQYSESCFSNSEYLIYKESQCRLRYLLELKM
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaagagacggtctgcttctgctaccaaagcgggcggcaagaagatcaaggca
gaacccgagctaccgaagcccaaagatgcattcacctcgaccaaagaggctcttctggct
gcagggccacaaaccaaaggaaagaagaaggtggacgaacactgctcactgtcaagcaaa
ggagaggtgtacaaagactatgactgcatgctcaattatacgaatgttcgaaacaactat
aatgacttctatgttattcaagtcattaaagctgccaaaaagtactattcatgggacaga
tggggcagagtgggttacgtgggttactccaatctgaatacgttttcagacgttaagagt
gccgtgaaggactttgaaaaaaagttcaaggacagcaccatgaacaattggagtgatcgc
atgaattttgtgtctcactctgggaagtacactttgattgaggtggatgcaggggtcacg
gtggacattgttgatggaacggctgtcaaggtcactaaaaacgtcctaccttgcaccctg
gacaaagctaaacaggcgctcatcgagctcattttcagcaatgatatgttcacggcggca
atggaatgtatgaacttagacgtcaagaagatgcctttgggtaagctcagcaagttgcaa
attgcaaagggcttcgaggtgctggaagaaattgaagcagccttgactcaaaagagcagg
aggccacgtcttgaagaactttcctccaagttttttacaacaatcccgcataacttcggt
cgcaccagaccaccaaccattgacaacaacaacattgtggaaaaaaagaaagagatgctg
atggtgcttgctgatattgagctcgctcagactctgaaatcagagacagagaaggcacag
aaagagatgatcgagactgtccccgacccgcttgaccaggactacagttctctcaagtgc
aaactctctctgttggataaaagatcaaaaacgttcaagataatcgacaaatacctaaag
caaacacagggctatcagaagcccaaaattgtcaacgtatgggaagtcgacagagaaact
gagggggctcgatttcaaaagcatgacgacctggagaaccgccgtctgctgtggcatggc
actaacatcgccgtcgtggctgctatactgaagagcggcctgaggataatgccccattcg
gggggccgtgttggacgcggtatctattttgcatccgaaaactctgtgtctgcatgttac
gtgcacatgtcgaaaaataccggcgtgatgtttttgagtgaagtggccctcggcagagaa
cacaccatcaccacagacaactcttctttgaaaaaggcgcctgctggatacgattctgta
gttgcacgaggtcgagtggaaccagatccgtccaaagacatcttcatcaccctggacggc
aaggaggtggccgtcccacagggtaagcctatcacgcagtctcagtactctgagagctgc
ttcagcaacagcgaatatctcatctacaaagagagtcagtgtcgcctgcgctacctgctt
gagctgaaaatgtaa

DBGET integrated database retrieval system