KEGG   Hippocampus comes (tiger tail seahorse): 109522300Help
Entry
109522300         CDS       T04969                                 

Gene name
gpx1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00480  Glutathione metabolism
hcq00590  Arachidonic acid metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109522300 (gpx1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109522300 (gpx1)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109522300 (gpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 109522300
NCBI-ProteinID: XP_019736283
Position
Unknown
AA seq 188 aa AA seqDB search
MATGFHNLTAKLLTGETFNFSSLRGKVVLIENVASLUGTTTRDYTQMNELHERYASKGLV
ILGVPCNQFGHQENNRNNEILPSLKHVRPGNGYEPKFQLLEKVDVNGKDAHPLFTFLRES
LPFPIDDPTSLMTDPKYIIWSPVCRNDVSWNFEKFLIGSDGVPFKRYSRKFLTIDIEGDI
KKLLSQAN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccggattccacaacctgacggccaagctgctcacgggcgaaacctttaatttc
tcctcgcttcggggcaaagtggtcctcattgagaacgtcgcgtctctctgagggacaacc
accagggattacacccagatgaacgagctccacgagcgatacgccagcaaggggctcgtt
atcctgggtgtaccctgcaaccagtttggccaccaggagaacaacaggaataatgaaatc
ctcccgtcattgaagcacgtccgacccgggaatggctacgagcccaagttccagctcttg
gaaaaggtagatgtgaatggcaaggatgcccacccactgttcacattcctgcgagagagc
ctcccgtttcccatcgacgaccccacctccctgatgactgaccccaagtatatcatctgg
agtcccgtctgcaggaatgatgtgtcctggaactttgagaagttcctcatcgggtcagat
ggtgtgcccttcaagcgttacagccgcaagttccttacgattgacatcgagggagacatc
aagaagctcttgagtcaagcaaactaa

DBGET integrated database retrieval system