KEGG   Hippocampus comes (tiger tail seahorse): 109522373Help
Entry
109522373         CDS       T04969                                 

Gene name
khk
Definition
(RefSeq) ketohexokinase isoform X1
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00051  Fructose and mannose metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    109522373 (khk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109522373 (khk)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     109522373 (khk)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109522373 (khk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 109522373
NCBI-ProteinID: XP_019736455
UniProt: A0A3Q2Y3B1
Position
Unknown
AA seq 356 aa AA seqDB search
MEGQGEHHKPKKILCVGLVCLDIISVVDAFPQEDSDSRCVSQRWQRGGNASNSCTVLSLL
GSPCAFMGSLCAGPVASFILEDFQRFQVEVHSPHERAACVTPTSLVISSAATGSRTILHM
NSFIVDDFSRRSIDISRLAWQTTGQTPSACCVVCPSSGSRTVLLADTNIPDVTCEDFSAV
DLSAFKWIHWEGRNADEQLKMMAEVARYNAASPPQHRIVVSVEIEKPREKLYQLFPHADV
VFVSKDVARHLGFHTPQSALQGLRGRLRAGAVMICPWAEKGADAVDADGTLLHSDAFPPE
RLLDTLGAGDTFNAAVIHKLANGCRLQDALTFGCRVAGTKCGFHGYDGIADKLTQV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaggggcagggagagcaccacaagcccaagaagattctgtgtgtcggcctcgtgtgt
ctggacatcatcagcgtggtggacgcatttccccaagaagattcggacagcaggtgtgtg
tcacagcgatggcagcgaggcggcaacgcgtccaattcgtgtacagttttatcacttctg
ggatcgccgtgcgcattcatgggatcactttgtgcaggacctgtggccagttttattttg
gaggattttcagaggttccaggtggaagtgcattcgccgcatgagcgcgccgcctgtgtc
acaccgacgtcgctcgtcatcagcagcgccgccacaggaagtcgcaccatcctgcacatg
aacagtttcatcgttgacgacttctcgcgtcggtccatcgacatttcgcggctggcgtgg
cagacgacgggccaaactcccagcgcatgttgtgtggtttgtccgtccagcggttctcgc
actgtcctgctggccgacaccaacattccagacgtgacgtgtgaagacttcagcgcagtg
gacctgagcgccttcaagtggatccactgggaggggcgcaacgcagacgaacagctgaag
atgatggccgaggtggcgcgatacaacgccgcgtcgccgccgcaacacaggatagtcgtc
tccgtggagatcgagaagcccagagagaagctttatcagctcttcccgcacgctgacgtg
gtatttgtgagcaaagatgtggctcgccacctgggctttcacacgcctcaaagcgctctc
cagggactccgaggtcgcctcagagcgggcgccgtcatgatctgcccttgggccgagaaa
ggagcggatgccgtggacgctgacggaacgctgctccattccgacgccttcccgcccgag
cgcctgctggacacgctgggagccggagacacgttcaacgccgccgtcatccacaagctt
gctaatggttgccgactgcaggacgcgctaacattcggctgcagggtggcgggcaccaag
tgtggtttccacggttacgatggcatcgcagacaaactgacgcaggtgtaa

DBGET integrated database retrieval system