KEGG   Hippocampus comes (tiger tail seahorse): 109522674Help
Entry
109522674         CDS       T04969                                 

Gene name
oxtr
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04020  Calcium signaling pathway
hcq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109522674 (oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109522674 (oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hcq04030]
    109522674 (oxtr)
G protein-coupled receptors [BR:hcq04030]
 Rhodopsin family
  Peptide
   Oxytocin
    109522674 (oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 109522674
NCBI-ProteinID: XP_019736991
Position
Unknown
AA seq 386 aa AA seqDB search
MESFLNQSDLWPVNDSWSSESNHTNPLKRNEEVAKVEVTVLALILFLALTGNLCVLAATH
SAKHSQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDLLCRLVKYLQVVGMFA
STYMLVLMSVDRCLAICQPLRSLHRRKDRFYVVFSWSLSMLLSIPQMFIFSLREVGSAGS
GVYDCWGDFVMPWGAKAYITWISLTIYIIPVGILSVCYGLISFKIWQNFKLKTRREQCMS
LTPKVGKGGGALARVSSVKLISKAKMTTVKMTFVIVLAYIVCWTPFFSVQMWSAWDHAAP
REAMPFIISMLLASLNSCCNPWIYMCFAGHLFHDLRQNFLCCPGRYLNSSRCRCERDLDS
SHKSISSTLVIKSTGSQRSITQTSST
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggagagctttttgaaccaaagtgacttgtggccggtaaatgactcgtggtcctccgag
tcgaaccacacgaaccccctgaagaggaacgaggaggtggccaaggtggaggtgaccgtc
ctcgccctgattctcttcctggcgctcaccggcaacttgtgcgtcctggcggccacccac
agcgccaagcacagccagtcgcgcatgtactacttcatgaagcacctgagcatcgccgac
ctggtggtggctgtcttccaggtcctgcctcagctcatctgggacatcaccttccgtttc
tacgggccggatctactttgcaggctggtcaaataccttcaggtggtgggcatgttcgcc
tccacttacatgctggtgctcatgtccgtggacaggtgcctggcgatctgccaacctctg
cgctccctgcacaggcggaaggatcgcttctacgtggtgttctcctggagcctcagcatg
ctcctcagcattcctcaaatgttcatcttctcccttcgggaggtgggctcggccggctcc
ggagtgtacgactgctggggcgacttcgtcatgccgtggggtgccaaggcgtacatcacg
tggatcagcctgaccatctacattatcccggtggggatcctgagcgtgtgctacggtctg
atcagcttcaaaatatggcagaactttaaactgaagaccagacgggagcagtgcatgagc
ctgacgcccaaggtcggcaaaggaggcggcgcgttggcgcgggtgagcagtgtcaaactc
atctccaaggccaagatgaccaccgtcaagatgacttttgtcatcgtgctggcgtacatc
gtgtgctggactcccttcttctccgtacagatgtggtccgcgtgggaccatgccgcccca
cgcgaggctatgcccttcatcatctccatgttgctggccagcctcaacagttgttgcaac
ccgtggatctacatgtgtttcgcgggccacctcttccacgacctgcggcagaatttcctg
tgctgccccggacgctacctcaattcgtcgaggtgccgctgcgagcgcgacttggactcc
agtcacaagagcatctcgtccaccttggtcattaagagcaccggcagccagaggagcatc
acgcagacgtccagcacgtga

DBGET integrated database retrieval system