KEGG   Hippocampus comes (tiger tail seahorse): 109523950Help
Entry
109523950         CDS       T04969                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109523950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hcq03012]
    109523950
Translation factors [BR:hcq03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    109523950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF2779
Motif
Other DBs
NCBI-GeneID: 109523950
NCBI-ProteinID: XP_019739024
UniProt: A0A3Q3EA88
Position
Unknown
AA seq 926 aa AA seqDB search
MSRFFATGSDSESEESSSADEIAPKAPGTTLKQSLLLSDDEEDTKRVVRSAKDKRFEELT
NLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKNIVDKEGVPPFYIRLLADLEDYLNQLW
EDKEGKKKMNKNNAKALSTLRQKIRKYNRDYETEITAYKENPQESADEEEDKGPDDSGSS
SDSDEDDDGVSAKSFLKKKPEAAPEASKFLKSAKGSGDESSSSDDDEDDEDWGSDTVDTG
SESSDDGEGKSASLAMVFLKKAHAPEKSSEKVGKKKKLKKKEKLEEEAEEEGGEEVEGGW
EKVRGGVPLVKEKPKMFAKGTEINTAVVVKKLHEILQARGKKGTDRTGQIELLHALAAIS
AEHNLGEGVLVKIKFNIIASLYDYNPNMATFMKPEMWKKCLDCIDELLNVLYDNSNMFIG
ENIAEDSENLAISDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEERVCG
IMDRLLTYLENKGTTEEICRIYLRRIMHTYYKFDYKAHRNSLAMQAETKSQQDQEESEAE
DSAIIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHAD
PPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQ
EKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGE
RQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQRVREMLVRK
IQEESLRTYLFTYSSVYDSISMATLSDMFELEIATVHSIISKMIINEELMASLDQPTQTV
VMHRTEPTSLQNMALQLAEKLGSLVENNERVFDLKQGVYGGYFNRDQKGGYQQKQSYQRD
GGKGGYQSKQGGYQRGGYRNQNQGNY
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttctttgccaccgggtctgacagcgagtcagaggagtcctcgtcagcagat
gagattgcacccaaagcacccgggaccacgctcaagcagtcgctgctgctcagtgatgat
gaggaggacaccaagagagttgtgcgcagtgccaaagacaaacggtttgaggagttgacc
aatctcatcaagactatccgcaatgccatgaagatccgcgacatggccaagtgtctggag
gagtttgagcagttgtgtcgagcgttcctcaaaagcaagaatatagtggacaaagagggc
gttccacctttctacatccgtcttttggcagacctggaggactacctgaatcagctatgg
gaggacaaagaggggaagaagaagatgaacaagaacaacgcaaaagccctcagcacattg
cgccagaagatccgcaagtacaaccgggattacgagacagaaatcactgcttacaaggag
aatccccaagagtctgcagatgaagaggaggacaagggcccagatgattcgggttcatcc
tctgacagcgatgaggatgatgacggtgtgtccgctaagtccttcttgaagaaaaaacca
gaggccgcgccagaagcgagcaagttcctcaagtccgccaaaggatccggggatgagtca
tcctccagtgacgatgacgaagacgacgaagactggggctctgacactgtggacaccggc
agtgagagctctgacgacggagaggggaagagtgcgtctctcgccatggtcttcctcaag
aaggcccacgcacctgagaagagcagcgaaaaagtggggaagaaaaagaagctgaagaag
aaagagaagctggaggaagaggctgaggaagagggaggtgaggaggtcgagggaggctgg
gagaaggtgaggggaggcgtccctctcgtcaaggagaagcccaagatgtttgccaagggt
accgagatcaacacagctgtggtggtgaagaagctccacgagatcctgcaagccagaggc
aaaaagggcaccgaccggactggccagattgagctgctccatgccctcgctgccatctcc
gcagagcataacctgggtgagggcgtcctggtgaaaattaaattcaacattattgcatcg
ctgtacgactacaatcccaacatggcaacctttatgaagccggaaatgtggaagaagtgt
ctggactgcatagatgagctgctgaacgtcctgtatgacaacagcaatatgttcatcggg
gagaacattgcagaggacagtgagaacttggccatctcagatcagcctttcagagtgcgc
ggctgcattttaactttggtggagaggatggacgaagagttcaccaagatcatgcagaac
acagatcctcattcacaagaatacgtggataatctcaaagacgaagagcgcgtttgcggc
atcatggaccgcctgctcacctacttggagaacaagggcaccacggaggagatttgccgc
atctatctgcgtagaatcatgcacacctactacaagtttgattacaaggctcaccggaat
agcctggccatgcaggcagaaacaaagtcccagcaggaccaggaggagagcgaggccgag
gacagcgccatcatcatggaccgcctctgcaagttcatctacgccaaggaccgcaccgac
cgcatccgtacgtgcgccatcctctgccacatctaccaccacgcgctgcattcgcgttgg
taccaggcccgcgacctgatgctcatgagccacctgcaggacaacatccagcacgccgac
ccacccgttcagatcctctacaacagaaccatggtccaactgggcatctgtgccttccgc
caaggcatgatcaaagacgcgcacaacgccttgctggacatccagtcctcgggccgtgcc
aaggagctgctgggtcagggtttactcatgaggaacatgcaggagaggaatgccgagcag
gagaagatcgagaagcgaagacaagtgcccttccacatgcacatcaacctcgagctgctg
gaatgcgtgtacctggtgtcggccatgttgctggaaatcccctacatggctgcccacgag
tttgacgcccgccgccgcatgatcagcaagcagttccaccatcagctgcgagtgggagag
cggcagccgctacttggccccccggaaagcatgcgcgagcacgtggtggcggccagcaag
gccatgaagatgggcgactggcgcacctgccactccttcatcatcaacgagaaaatgaac
agcaaagtgtgggacctcttccccgagacgcagcgagtgcgcgagatgctcgtcaggaag
atccaagaggagtcgctgaggacgtacctcttcacttacagcagcgtgtatgactccatc
agcatggcgacactgtctgacatgtttgagttggagatagcaacagttcatagcatcatc
agcaaaatgatcatcaacgaggagctcatggcctctctggaccagcccacgcagacggtg
gtgatgcaccgcacggagcccacctccctgcagaacatggcgctgcagctggccgagaaa
ctgggcagcctggtggagaacaacgagcgcgtcttcgacctcaagcagggcgtctacggc
ggatacttcaacagagatcagaaaggcggatatcaacagaaacagtcgtaccagagagac
ggaggcaagggcggttaccaatccaagcaaggcggctaccagcgaggaggctacaggaat
cagaaccaaggcaactattga

DBGET integrated database retrieval system