KEGG   Hippocampus comes (tiger tail seahorse): 109524302Help
Entry
109524302         CDS       T04969                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04020  Calcium signaling pathway
hcq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109524302 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109524302 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hcq04030]
    109524302 (htr4)
G protein-coupled receptors [BR:hcq04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    109524302 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 109524302
NCBI-ProteinID: XP_019739640
Position
Unknown
AA seq 390 aa AA seqDB search
MSVSPSGYMPVMEELFTDSNSMPKRLALICFLSLVMAMSILGNLLVMVAVCKDRQLRKIK
TNYFIVSLAFADLLVSLLVMPFGAIDLVHQQWIYGETFCLVRTSLDVLLTTASIMHLCCI
ALDRYYAICCQPLVYRNKMTPMRVALMIGGCWVIPTFISFLPIMQGWNTIGIDHVIDERR
HTEGSNTTSCVFLVNQPYAVTCSVVAFYIPLVLMVLAYQRIYVTARAHALQIGALQRAGG
ASSSSDSADQQRNHRMRVETKAAKTLCVIMGCFCLCWAPFFITNVVDPFIGYTVPDQLWA
ACLWLGYINSMLNPILYAFLNKSFRRAFLSILCCGRKRYRRPSVLVGPRAACAATHINGS
THVLKYSVLHNGNHTAQEKKMLHDHAESCL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcagcccttcaggctacatgccggtgatggaggagcttttcactgacagcaac
agcatgccaaagcggttggcactcatctgcttcctgtctcttgtaatggcgatgagcatc
ctgggaaacctactggtcatggtggctgtctgcaaggacaggcaactcaggaaaatcaag
accaactacttcatcgtgtcgttggccttcgctgacctgctggtgtcgttgctggtaatg
ccattcggcgccatcgacctggtgcatcagcagtggatctacggcgaaaccttctgcctg
gtgcgcacctcgctggatgtgcttctcacgaccgcctccattatgcacctgtgctgcatc
gccctcgacaggtactacgcgatctgttgccagcctttggtgtaccgcaacaaaatgaca
cccatgcgcgtggcccttatgattggcggatgctgggtaatccccaccttcatctccttc
ctgcccatcatgcaaggatggaacaccatcggcatcgaccatgtgatcgacgagcgtcgc
cacacggaaggcagcaacaccacgtcgtgcgtgttcctggtgaaccaaccttacgcagtg
acgtgctcagtggtggccttctacatcccgctggtgctgatggtgctggcctaccagcgg
atctacgtgacggcgcgggcgcacgccctccagatcggcgcactgcagcgggcgggtggc
gcctcatcgtcatcggactcggccgaccagcagcgcaaccaccgcatgcgcgtggagacc
aaggcggccaagacgctgtgcgtcatcatgggctgcttctgcctttgctgggcgcccttt
ttcatcaccaacgtggtggaccccttcatcggctacacggtgcccgaccagctgtgggcg
gcctgcttgtggctgggctacatcaactccatgcttaaccccatcctctacgccttcctc
aacaagtccttccgccgtgccttcctcagcatcctgtgctgcgggcgcaagcgctaccgc
cgaccctccgtgttggtgggcccgcgcgcggcctgcgccgccacacacatcaacggctcc
acgcacgtgctcaagtattcggtgcttcacaacgggaaccacacggcacaggagaagaaa
atgctgcacgaccatgcagagtcctgtttgtga

DBGET integrated database retrieval system