KEGG   Hippocampus comes (tiger tail seahorse): 109524326
Entry
109524326         CDS       T04969                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04080  Neuroactive ligand-receptor interaction
hcq04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109524326 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109524326 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 109524326
NCBI-ProteinID: XP_019739672
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASMDHGRELEEAAPVRKLVQQSPSRGGQSHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagattctgacgctggtgattgtgctcctggtgtctctgctgtgttctgcc
agtgctggtccaatggcctccatggatcacggcagagagctggaggaagcagctccagtg
agaaagctggtgcagcaaagcccttcgaggggcggtcagagccacaggccagccggctgg
aagaggagacgcccacggccccgtctttcccacaaggggccaatgccgttctag

DBGET integrated database retrieval system