KEGG   Hippocampus comes (tiger tail seahorse): 109524800Help
Entry
109524800         CDS       T04969                                 

Definition
(RefSeq) nucleoside diphosphate kinase A2-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq00240  Pyrimidine metabolism
hcq00983  Drug metabolism - other enzymes
hcq01100  Metabolic pathways
Module
hcq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hcq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
hcq_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109524800
   00240 Pyrimidine metabolism
    109524800
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109524800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109524800
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     109524800
Membrane trafficking [BR:hcq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109524800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-GeneID: 109524800
NCBI-ProteinID: XP_019740461
UniProt: A0A3Q2XRZ7
Position
Unknown
AA seq 152 aa AA seqDB search
MAEQKERTFIAIKPDGVQRGIIGEVITRFERKGFKLAAMKMLQASEDLLMEHYSDLKERP
FFPHLVNFMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHG
SDSVESATKEIALWFKQEELTSYTSCASSWIY
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagaaggagcgcacctttattgccatcaagcctgacggcgtgcagagaggc
atcatcggggaggtcattacgagatttgagaggaaaggtttcaaacttgcggcgatgaaa
atgcttcaagcttcggaggacctgctgatggagcactacagtgacctgaaagaacgtcca
tttttcccgcacctcgtcaatttcatgagcagtggtccggtggttgccatggtgtgggaa
ggcaaaggggttgttaagaccggcagggtgatgcttggtgaaaccaacccagcagactca
aaacctggaacaattagaggagacttctgcattgatgttagcaaaaacatcatccatgga
agtgactcagttgagagtgctacaaaggaaattgccctgtggttcaagcaagaagagctg
acttcctacacaagctgtgcctccagctggatctactga

DBGET integrated database retrieval system