KEGG   Hippocampus comes (tiger tail seahorse): 109524850Help
Entry
109524850         CDS       T04969                                 

Gene name
ppil4
Definition
(RefSeq) LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase-like 4
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hcq03041]
    109524850 (ppil4)
   03110 Chaperones and folding catalysts [BR:hcq03110]
    109524850 (ppil4)
Enzymes [BR:hcq01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109524850 (ppil4)
Spliceosome [BR:hcq03041]
 Complex C
  Other components
   PPlases
    109524850 (ppil4)
Chaperones and folding catalysts [BR:hcq03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    109524850 (ppil4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1
Motif
Other DBs
NCBI-GeneID: 109524850
NCBI-ProteinID: XP_019740526
Position
Unknown
AA seq 456 aa AA seqDB search
MAVLLETTLGDIVIDLFTEERPKACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTG
RGGESVFCKLYGDQARFFDSEKAPRIKHRKKGTVSMVNNGSDQHGSQFLITTGENLDYLD
GVHTVFGEVSEGLDIVAKINETFVDTDFVPFQDIRINHTVILDDPFDDPLDLPVPDRSPE
PTKEQLDSGRIGADETIDDADGKAAEEVEERLQEKEAKTRAILLEMVGDLPDADVKPPED
VLFVCKLNPVTTDEDLEIIFSRFGHIKSCEIIRDWKTGDSLCYAFIEFEKQEDCEKAYFK
MDNVLIDDRRIHVDFSQSVSKIKWKGKGGKYTKEDFKAYENDLEKRSKLTLKDQAKPKQD
SRYDLLXEEAPGQKKHKEKRHHHSDAEESKKSKKHKDDDGGRRDRKMDRQRSRSRDRERR
HAKSRDKYVKGGRDRSRRSRSQSPRKSKVQDRSRYR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccttcttgaaacgacgctcggtgatattgtgattgatttattcacagaagaa
aggccaaaagcttgcctcaactttctgaaattatgcaagataaaatactacaactactgc
cttatccacaacgtacagagagacttcatcatccaaactggggaccccacggggacgggt
cggggtggagagtcggtcttctgcaaactgtacggagaccaggcccgttttttcgattcc
gagaaagccccacgtattaaacacagaaaaaagggaacggtgtccatggttaacaatgga
agtgaccagcatggttcacagttccttattaccactggcgaaaacctggattacctggat
ggggtgcatactgttttcggggaagtgtcagagggattggacattgtggctaaaatcaac
gagacttttgttgacacagactttgttccatttcaggacatcagaataaaccacacggtg
atcctcgatgacccttttgatgaccctctggatctcccggtgcccgatcgctctcctgag
cccaccaaagagcagctcgatagcggccggattggcgctgacgaaacgatcgacgatgcc
gacgggaaagcggctgaagaagtggaggagagacttcaggagaaagaagccaaaacccga
gccatcctgctggagatggtgggcgacctccccgacgcagacgtaaagcctcccgaggat
gtgctctttgtgtgcaagctgaacccagtgaccacagatgaggatctggaaatcatcttt
tctcgctttggccacattaaaagctgcgaaatcattcgtgactggaaaactggagattcc
ctctgctacgctttcatcgaatttgaaaagcaagaagactgtgaaaaggcctactttaaa
atggataacgtgctcatcgacgatcggcgcattcatgtcgatttcagccagtctgtgtca
aagatcaaatggaaggggaaaggtgggaagtacaccaaagaagacttcaaggcttatgag
aacgacttggagaagcgctccaaactgactctgaaagatcaagcgaagcccaaacaagat
tcccgatatgacctcctcnnggaggaggcgccgggacagaaaaaacataaagagaagaga
catcatcattcggatgccgaagaaagcaagaagtccaaaaaacacaaggacgacgatggc
ggccggcgggacagaaagatggaccggcagcgctcccgctcccgagacagggaacgcagg
catgccaaatccagggacaaatacgtgaaaggcgggcgggacaggagtcggaggagtcgc
agtcagtcgcccaggaagtccaaggtccaagacagaagcagatacagatga

DBGET integrated database retrieval system