KEGG   Hippocampus comes (tiger tail seahorse): 109525164
Entry
109525164         CDS       T04969                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109525164
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109525164
Peptidases and inhibitors [BR:hcq01002]
 Metallo peptidases
  Family M1
   109525164
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109525164
NCBI-ProteinID: XP_019741016
Position
Unknown
AA seq 939 aa
MLVAPLCLVVFLYLGQALGAQLPHLNWRDINGAQPFPWLHMRLPQTVVPVHYDLTIHPNL
TTLSFTGVVRIQLDVLEETKAIILHAKQLKTFNVKLKTSEGLRSLEVIENSVYQQLALLS
HEVIPKGRDYEVHMEFAANLSDSFHGFYKSSYRTSSGELRTLASTQFEATFARTAFPCFD
EPAFKANFTISIVREARHIAISNMPKIKTVALPGNVFEDHFATTVKMSTYLVAFIVSDFH
SVSKTTQHGVKISVYAVAEKINQTDFALDAAVKLLDFYDDYFNIPYPLPKQDLAAIPDFQ
SGAMENWGLTTYRESALLFHPEKSSVTDKVHIAKIIAHELAHQWFGNLVTMEWWNDLWLN
EGFAKFMEFIAVNATYPQFQVNDLFMGKCYTAMEVDSLRSSHPVSTAVENPTEIQEMFDR
VSYDKGACLLNMLKDFLTPDVFEVGILRYLKRYSYKNTANSHLWESLTNVCDLNDLPGAP
TKQKEFCSKHILPSGENYDGEKFDIKTVMDTWTLQKGFPLVNIDLKSRKLILTQERYLMT
EPEPATTKAPVETPVWQIPLTYKTSDSATTHHHLMRNAVDLFRVPNGVDWVKFNVDMSGY
YVVHYGKEGWKNMIKLLHKNHTALSGKDRASLIHDAFRLVSIKKLGLETALDLSAYLSKE
TDIISVTQGFQELLPIYKLIQRRXLGLLEDGMKSFMLDLFKHLIDSQSWDDSGSASERML
RSSLLLFACVRNYTPCVTKAKHLFNLWRDTDGQMSLPIDVTLAVYAVGAQTEEGWDFLFE
FYRRALQTSVQTRIRIALASSPLHQKLKWILEQSLLGEVIKTQDLPHVLVSVSRNPRGHR
LAWDFLRANWQTLIKKFEVGSSSIARMVKGVTGLYSTKTMLSSVEKFFSSLTVEMGSEMR
CIQQTYDAIHENIRWGETNFSVLQSWLKKQMTRFIHEDL
NT seq 2820 nt   +upstreamnt  +downstreamnt
atgttagtggctcctctctgcttggtggtctttctttacctcggccaggcgttgggggca
cagcttccacatttaaactggcgtgacatcaacggtgctcagccgttcccctggcttcat
atgagactcccccaaacggtcgtacccgtgcactacgacctgacaattcaccccaacctg
accactctgagcttcaccggagtcgttcgcatccagctggatgtactcgaagagaccaaa
gccatcattttacacgcaaagcagttgaagaccttcaacgtgaagctcaagacgtccgag
gggttgaggtctcttgaggttatcgagaattctgtttaccagcagcttgccctgctctca
catgaggtgatccccaaagggcgggactacgaggttcatatggagtttgccgcaaacctc
tcggacagcttccacggtttttataagagcagctaccgcaccagcagcggggagctccgg
actctggcatcgacgcagtttgaagccacgtttgctcgaacagccttcccttgttttgat
gagcccgccttcaaagccaacttcaccatctccattgtacgcgaggcacgacatatcgcc
atctccaatatgcccaagataaaaacggtggcgttacccggaaatgtgtttgaggatcac
tttgccaccacggtaaagatgagcacgtatttggtcgccttcatcgtgtctgacttccac
tccgtcagcaagacgacccaacatggcgtcaagatttccgtctacgccgtagctgagaaa
atcaaccagacggacttcgcgctggacgccgccgtgaagctgctcgacttttacgacgac
tacttcaatatcccttacccactccccaaacaggaccttgctgctattcccgatttccag
tcgggagcgatggagaactggggcctgaccacctacagggagtcggcccttctcttccac
cccgaaaaatcctccgtcactgacaaagtgcacatcgccaagattatcgctcacgagctt
gcgcaccagtggtttggcaacctagtgacgatggagtggtggaacgacttgtggctcaac
gagggtttcgccaaattcatggagtttattgctgtcaacgccacctacccgcagttccaa
gtgaacgacttattcatgggcaagtgttacacagccatggaggtcgacagtctccgctca
tcccacccggtttccaccgctgtggaaaaccccaccgagatccaggaaatgtttgacaga
gtgtcctacgataagggagcgtgccttctgaacatgctgaaagacttcctgacacctgac
gtgttcgaggttggcatcctccgctacctgaagcgctatagctacaaaaacaccgccaac
agccacctgtgggagagcctgaccaatgtttgcgatctgaatgatctgccaggcgcgccg
acgaaacaaaaagaattctgctcaaaacacatcctcccatcgggagaaaactacgatggc
gagaagtttgacatcaagaccgtcatggacacgtggacgctacagaagggcttcccgctc
gtcaacatcgacttgaaatcgcgcaagctcattctcacccaggagcgttacctgatgacg
gagccggagcccgccaccactaaagcccctgtggaaacgcccgtttggcagattccactc
acatacaagacaagtgactctgccacaacacaccaccacctgatgagaaatgcagtcgat
ctctttcgcgttcccaacggcgtggactgggtcaagttcaacgtggacatgagcggctac
tacgtcgttcactacggcaaagaggggtggaagaacatgattaaactgctgcacaaaaac
cacacggcgctgagcggcaaggaccgagccagtctcatccatgacgccttccggctcgtc
agtatcaagaagctgggcctggaaacagctctggacctgtccgcatatctctccaaggag
accgacatcatatcagtgactcagggctttcaagagctcctccccatctacaaactgata
caaaggaggtagcttggtcttctcgaagacggcatgaagagtttcatgctagacctgttc
aagcacttgattgacagtcagagttgggacgattctggttcggcgtcggagcgaatgctg
cgcagctccctgctgctgttcgcctgtgtcaggaactacaccccttgtgtgacgaaagcc
aagcacctgttcaacttgtggagggacacggatggccaaatgagcctccccatcgacgtc
accctggccgtgtatgccgtcggggctcaaacagaggaagggtgggacttcctgtttgag
ttctaccgccgggccttgcaaacgtccgttcagacccgcatcaggattgccttggcgagc
agcccgttgcatcaaaagctcaagtggattctggagcagagcctcctcggcgaggtgatt
aaaactcaagacctgccacacgtgttggtctctgtcagcaggaacccccgaggccacaga
ctagcgtgggacttcctccgagccaactggcagaccctgatcaaaaagtttgaagttggc
tcctcctccatagcgcgcatggtgaagggcgtgaccggcctgtactccaccaagacaatg
ctatcgtcggtggagaagttcttcagctctcttacggtggagatgggctcagagatgcga
tgtatccagcagacctatgacgccatccatgagaacattcgctggggcgaaaccaacttc
tccgtgctgcagtcctggctgaaaaaacagatgaccaggtttattcatgaggacttgtaa

DBGET integrated database retrieval system