KEGG   Hippocampus comes (tiger tail seahorse): 109525557
Entry
109525557         CDS       T04969                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq00240  Pyrimidine metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109525557 (dck)
   00240 Pyrimidine metabolism
    109525557 (dck)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109525557 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 109525557
NCBI-ProteinID: XP_019741686
Position
Unknown
AA seq 306 aa
MLCGRWRLSRIRYLLDKSHVIFSNNYASFQHGNILTSSIANNNMFLTPKRPRSDFMNDSM
EKRIKRISIEGNIAAGKSTFVRLLEQECADWEVVPEPIARWCNVQTSGSDFEELTSSQRS
GGNVLKMMYDKPERWAYTFQSYACISRVRAQIRSANGKLREADDPVQFFERSIYSDRYIF
AANLYENECLNDTEWSIYQDWHGWLHSQFSRHIQLDGIIYLRVPPEKCMERLHLRGREEE
QEIPLEYLEKLHVKHESWLQHKTMTMDFEYLADLPVLTLDATEDFKGNESKSADMMEKVK
EFLSTL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgttgtgtgggaggtggcgtctttctcgcatccggtatctccttgataaatcccacgtt
atattctcgaacaattacgccagctttcagcatggaaacattttaacgtcatcaattgcc
aacaacaacatgtttttaacccccaagaggccgcgctccgacttcatgaacgactcgatg
gagaagaggataaagcggatttccatcgagggcaacatcgcggcgggaaagtcgaccttc
gtccgccttctggagcaagagtgcgccgactgggaggtggtgcccgagcccatcgccagg
tggtgcaacgtgcaaacaagcggcagtgactttgaggagctgacgtcgtcgcagcgtagc
ggcggcaacgtgctgaagatgatgtacgacaagccggagcgttgggcctacaccttccag
agctacgcctgcatcagccgcgtgcgcgcccagatccgctcggccaacgggaagctgcgg
gaggccgacgaccccgtgcagttcttcgagcgctccatctacagcgacaggtacatcttc
gccgccaacctctacgagaacgagtgcctgaacgacacggagtggtccatctatcaggac
tggcacggctggctgcacagccagttcagccggcacatccagctggacggcatcatctac
ctgagggtccccccggagaaatgcatggagaggctgcacctgcgcggtcgcgaggaagag
caggaaatccctctggagtatctggagaagctccacgtcaagcacgagagctggctgcag
cacaagaccatgacgatggactttgagtatttggccgacttgccggtgctgacgctcgac
gccacggaagacttcaaaggcaacgagagcaagagtgccgacatgatggagaaagtgaaa
gagttcctgagtaccttgtga

DBGET integrated database retrieval system