KEGG   Hippocampus comes (tiger tail seahorse): 109526516Help
Entry
109526516         CDS       T04969                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00010  Glycolysis / Gluconeogenesis
hcq00562  Inositol phosphate metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109526516
   00562 Inositol phosphate metabolism
    109526516
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109526516
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109526516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109526516
NCBI-ProteinID: XP_019743400
UniProt: A0A3Q3DSN8
Position
Unknown
AA seq 477 aa AA seqDB search
MLFVVTSVVFVILSSRHGCSAADVPNFAAHFGSKTRYEDSAAHRRLLAELNAGPRLHTDP
GSLLRTPNGERCSPMHLTAVVRHGSRYPTVKNIRAIRQLSNLLRRVDGQQTQEAQMGERG
EGSAAWNRDVLRRWDMWYTDDMDGQLVAKGREDLQQLATRLSTLFPSLLGEESVRGGRIH
VVTSSKHRCVRSAEAFQEALHVRANITPVQYRHQVDDGLLRAYDGCPGYVESVEKNRTAL
AEVDKFKRGPEMEALRKKVADKLGLPLQDFTPDLLEVAYFLCAYELAIKSLHSPWCFLFE
PSDAKVLEYKCDLKLFWKRAHGYAINLLASCPLFHHIFRTLDKAGRPRRKTDTPPDPASI
LIGHAETLLPLLGLLGLYKDETPPTADNYHTQDGRHFRSSLLVPYAANMILVLLDCARGP
RLQLLVNEEPVRFPGLPHEDAPLYRDVRAAYRHLLDGCDYHKACSSTAGGRGPNTEL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcgtcgtcacgtccgtcgtttttgtgatcttgtcgagccgccacggctgctca
gcggcggacgtgccaaacttcgcggcccatttcggctccaagacccgctacgaggactcc
gccgcccaccggaggctgctcgcggagctcaacgccgggcccaggctccacacggacccg
ggctcgcttctgaggaccccgaacggagagcgttgctccccgatgcacctgaccgctgtt
gtccgccacggcagccgctacccgactgtcaagaacatccgcgccattcgccaactcagc
aacctgctgcgacgagttgatggccaacagacccaagaagcccaaatgggcgaacgaggc
gaaggctctgcggcctggaaccgggacgtcctgcgccgctgggacatgtggtacactgac
gacatggacggtcagctggtggccaaaggtcgagaggatctgcagcagctggcgactcga
ctttccactttgtttccatccttgttgggggaggagtcggtgcgtgggggacgcattcac
gtggtgaccagctccaagcatcgatgcgtgaggagcgccgaggccttccaggaagcactt
cacgtcagagccaacataacaccggtgcaataccgccaccaagtggatgacggtctgctt
cgtgcttatgatggttgccctggctatgtggagagtgtggagaagaaccgcactgcgttg
gccgaggtcgacaagttcaagcgcggcccggagatggaggcgctgaggaagaaagtggca
gacaaattgggccttcctctccaagacttcacgccagatcttctggaggtggcctatttt
ctttgtgcttacgagctggccatcaaatcgctgcactcgccctggtgtttcctgtttgag
cccagtgatgccaaggttctggagtacaagtgcgacctgaagttgttctggaagcgggcg
cacggctacgccatcaacctgctggccagctgcccgcttttccatcacatcttcaggacc
ctggacaaggccggacggccgcgcaggaaaaccgacacgccgccggatcccgcctctatc
ctgattggccacgctgagacactcctccctctcctcggtttgctgggcctctacaaggat
gagactccacccactgcagacaactaccacacgcaggacggtcgccatttccgttcaagt
ctgctggtgccgtacgcggccaacatgatcttggttctgttggactgcgcgcgaggcccc
cggctgcagctgctggttaacgaggagcccgttcgattcccaggcttgccgcacgaggac
gcgccactgtaccgtgatgtccgggcggcgtaccgtcacctgctggatggatgtgattat
cacaaggcgtgcagcagcacggctggcgggcgcggacccaacacggagctctga

DBGET integrated database retrieval system