KEGG   Hippocampus comes (tiger tail seahorse): 109527917Help
Entry
109527917         CDS       T04969                                 

Gene name
wdr45
Definition
(RefSeq) WD repeat domain phosphoinositide-interacting protein 4
  KO
K22991  WD repeat-containing protein 45
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109527917 (wdr45)
Membrane trafficking [BR:hcq04131]
 Autophagy
  Other autophagy associated proteins
   Others
    109527917 (wdr45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 CNH CPSF_A
Motif
Other DBs
NCBI-GeneID: 109527917
NCBI-ProteinID: XP_019745677
UniProt: A0A3Q2Z8G2
Position
Unknown
AA seq 358 aa AA seqDB search
MAQRRGVISLQFNQDHSCFCCSMESGVRIYNVEPLMEKGHLDHEQVGSVASCSMLHRSNL
LAVVGGGISPKFSEISVLIWDDARECRDAKDKLVLEFTFTKPVLAVRMRHDKIVMVLKNR
IYVYSFPDTPLKLFEFDTRDNPKGLCDLCPSLDKQLLVFPGHKCGSLQLVDLSNTKPGTS
SAPFTINAHQSEIACVALNQPGSVVASASRKGTLIRLFDTNSRDKLVELRRGTDPATLYC
LNFSHDSSFLCASSDKGTVHIFALKDTKLNRRSALARVGKVGPVIGQYVDSQWSLASFTV
PAECACICAFGKNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDVYLDICDDDDF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgcagaggagtcatcagcctgcagttcaaccaggaccacagttgtttctgc
tgctccatggagtcgggcgtgcgcatttacaacgtggagccgttgatggagaaaggccac
cttgatcacgagcaggtgggcagcgtggcgtcgtgctccatgctgcatcgctccaacctg
ctggctgtggttggaggcggaatcagtcccaagttctccgagatatctgtgctgatctgg
gacgacgcgcgtgagtgtcgggacgccaaagacaagctggtgctggagttcaccttcact
aagccggtgctggcggtccgaatgcgacacgacaagatcgtcatggtgttgaagaacagg
atctacgtgtacagctttcccgacacaccgctcaagctctttgaatttgacacgcgcgac
aaccccaaaggtctgtgcgacttgtgtccgagtctggacaagcagctgctggtcttcccg
ggacacaaatgtggaagtctgcaactggtggatctgtccaacaccaaaccggggacgtcg
tcggcgccgttcaccatcaacgcgcaccagagcgagatcgcctgcgtggcgctcaaccag
ccgggaagcgtggtcgcctcggcctctcgcaaggggacgctcatacggctctttgacacc
aacagccgcgacaaactggtggagctgcggcgaggcaccgaccccgccaccctctactgc
ctcaacttcagtcacgattcgtcgttcttgtgcgcgtccagcgacaaggggacggtccac
atcttcgccctgaaagacaccaaactcaaccgccgctccgcgttggcacgtgtgggcaag
gtgggccccgtgatcggtcagtacgtggatagccagtggtcgctggccagcttcaccgtg
cccgccgagtgtgcctgcatctgcgccttcgggaagaacacgtccaagaacgtcaactcc
gtcatcgccatctgcgtggacggcaccttccacaagtacgtcttcacgcccgacggaaac
tgcaaccgcgaagccttcgacgtctacttggacatttgcgatgacgatgacttttga

DBGET integrated database retrieval system