KEGG   Hippocampus comes (tiger tail seahorse): 109528715Help
Entry
109528715         CDS       T04969                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hcq01002]
    109528715
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109528715
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S33
   109528715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr LIDHydrolase Thioesterase DUF1057 Lipase Abhydrolase_3 Esterase
Motif
Other DBs
NCBI-GeneID: 109528715
NCBI-ProteinID: XP_019747207
Position
Unknown
AA seq 351 aa AA seqDB search
MDNFCVLSRIRMAAELDIVNLFIIAGGTLAIPLLAFIAFFLLWPSALIKIYYWYWRRTLG
LQVHYADCGGYRFCYSCRGKPGMRPSVLMLHSFSAHKDTWLTLVKYLPKHLHIVCVDMPG
HEGTTRTNTDDYSIVGQARRIHQFVETIRLTRKPFHVVGTSMGGNVAGVYAATYPTEICS
MTLICPDGIKHPCETKFDNHLQDLERSNYTLNIPLIPTTPEEMEDMFRLCSHVRFKIPQQ
ILQGLVDVREPHNSFYEEVFLEIISEKSRYALQEHLHLITAPVQVIWGKRDQVMDVSGAT
VIAEILPGCRVDLLENCGHSVVMERPCRTAKLILEFIILQQEARGGTKKSS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggataacttttgtgttttatccaggataagaatggcagcagaattagacattgtgaat
ctgttcataattgctgggggtacactggctattccccttttggcattcatcgctttcttc
cttttgtggccgtcagcgctcattaaaatctactattggtactggaggagaactctgggt
ctccaggtccattatgcggactgcgggggctaccgcttctgttactcctgccgaggaaag
cctggaatgaggccttccgttctcatgttgcacagcttctctgctcacaaagacacttgg
cttacacttgtcaagtacctaccaaaacatctgcacattgtgtgcgtggacatgccaggc
cacgaggggacaacccgcaccaacacagacgattattccattgtggggcaggccaggagg
attcatcagtttgtggaaaccattcgcttaactcggaaacctttccatgtggttgggacc
tccatggggggaaatgtagctggagtgtatgccgccacctacccgactgaaatttgcagc
atgacgctcatttgtccagatggtatcaaacacccatgtgagaccaagtttgataatcat
ctgcaagatctggaacgtagcaattacacactaaatatcccactgatcccgaccacgcct
gaggagatggaagacatgttcagactgtgttcccatgttcgctttaagatacctcaacag
attcttcaaggtcttgtggatgtccgagagcctcacaactctttttatgaagaagtgttt
ctcgagattattagtgagaaatccagatatgctttacaggaacacttgcatctcatcacc
gcacctgtacaggtgatatggggcaaacgggaccaggtgatggatgtgtctggtgccaca
gtcatcgcagaaatcttgccaggatgcagagtggacctgctagagaactgtggccactct
gtggtgatggagaggccttgtcggacagccaaactcatcctagagttcattatcctgcag
caagaagcaaggggtggcacaaagaaatcatcttga

DBGET integrated database retrieval system